Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27100 244 / 2e-75 ATGLR2.1 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.1, glutamate receptor 2.1 (.1) AT2G24720 242 / 2e-74 ATGLR2.2 glutamate receptor 2.2 (.1) AT4G31710 239 / 2e-73 ATGLR2.4 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.4, glutamate receptor 2.4 (.1) AT5G11180 232 / 1e-70 ATGLR2.6 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.6, glutamate receptor 2.6 (.1) AT2G24710 230 / 6e-70 ATGLR2.3 glutamate receptor 2.3 (.1) AT2G29120 229 / 2e-69 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) AT2G29110 222 / 9e-67 ATGLR2.8 glutamate receptor 2.8 (.1) AT2G29100 214 / 3e-64 ATGLR2.9 GLUTAMATE RECEPTOR 2.9, glutamate receptor 2.9 (.1) AT5G11210 162 / 7e-46 ATGLR2.5 ARABIDOPSIS THALIANA GLU, glutamate receptor 2.5 (.1) AT3G07520 120 / 5e-31 ATGLR1.4 glutamate receptor 1.4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G270400 [exp] 405 / 7e-136 AT2G29110 874 / 0.0 glutamate receptor 2.8 (.1) Potri.006G268400 [exp] 404 / 2e-135 AT2G29110 835 / 0.0 glutamate receptor 2.8 (.1) Potri.006G268700 [exp] 402 / 2e-134 AT2G29120 855 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Potri.006G268200 [exp] 399 / 2e-133 AT2G29120 841 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Potri.006G268900 [exp] 398 / 3e-133 AT2G29110 882 / 0.0 glutamate receptor 2.8 (.1) Potri.018G011500 [exp] 343 / 3e-112 AT2G29110 793 / 0.0 glutamate receptor 2.8 (.1) Potri.018G012000 [exp] 337 / 1e-109 AT2G29110 821 / 0.0 glutamate receptor 2.8 (.1) Potri.018G012300 [exp] 337 / 2e-109 AT2G24720 822 / 0.0 glutamate receptor 2.2 (.1) Potri.018G013200 [exp] 335 / 5e-109 AT2G29120 882 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026235 [exp] 259 / 2e-80 AT2G29120 912 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Lus10020109 [exp] 239 / 5e-73 AT2G29120 822 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Lus10003436 [exp] 234 / 2e-71 AT2G29120 867 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Lus10026913 [exp] 148 / 2e-40 AT2G29120 790 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1) Lus10026877 [exp] 125 / 4e-36 AT2G29110 120 / 9e-32 glutamate receptor 2.8 (.1) Lus10039671 [exp] 99 / 2e-23 AT1G05200 1239 / 0.0 glutamate receptor 3.4 (.1.2) Lus10027171 [exp] 98 / 5e-23 AT1G05200 1243 / 0.0 glutamate receptor 3.4 (.1.2) Lus10039672 [exp] 94 / 7e-22 AT2G32400 969 / 0.0 GLUTAMATE RECEPTOR 3.7, glutamate receptor 5 (.1) Lus10027170 [exp] 92 / 3e-21 AT2G32400 970 / 0.0 GLUTAMATE RECEPTOR 3.7, glutamate receptor 5 (.1) Lus10035980 [exp] 89 / 4e-20 AT3G51480 1149 / 0.0 glutamate receptor 3.6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0144 [poplar] [flax] Periplas_BP PF13458 [poplar] [flax] Peripla_BP_6 Periplasmic binding protein
Representative CDS sequence Show only first row Show all	>Potri.006G268450.1 pacid=42769716 polypeptide=Potri.006G268450.1.p locus=Potri.006G268450 ID=Potri.006G268450.1.v4.1 annot-version=v4.1 ATGATCATGAAAAAATACTCTTTAAATCCTGTTCTATCTTCATTTTTCTTCCTTTCTTTGATGATTTTGTTCTCAGAAATGGGGGTGGCCCAGAACACAA CATCTACAATCCCAGTGAATGTAGGAGTGGTTCTTGACTTGGCTTCTTTGGAGGCCAATATTGCTTTGAGCTGCATCAACATGGCCCTTTCAGACTTCTA TGCCTCTCATGGTGACTACAAAACTAGACTGGTCCTCAACACCAGGGACTCAAAGAAAGATGTTATTGGTGCAGCTGCTGCAGCCCTGGACTTGATAAAA AATGTGGAAGTGCAAGCAATCTTAGGGCCAACAACATCAATGCAAGCCAATTTTGTTATTGACCTTGGAGAAAAAGCTCATGTGCCAATTATATCTTTTT CTGCAACCAGTCCCTCTCTTACTTCCATCGGGAGTTCATATTTCTTGCGAGCAACACAAAATGATTCAGCTCAAGTGAATGCCATAAGTGCTATAGTTCA AGCCTTTGGATGGAAAGAAGCGGTGCCCATCTACATTGACAATGAATATGGAGAGGGAATCATACCTTATTTAACTGATGCTCTGCACGTAGTTGATGCT CGAGTGCCCTACCGGAGTGTCATTTCTCCATCGGCCACTGATGTTCAAATTGTTGAGGAGCTTAATAAGTTGATGACAATGTTAGGATATTGCCATTTAG TGGCAATACCCCACCACTAA
AA sequence Show only first row Show all	>Potri.006G268450.1 pacid=42769716 polypeptide=Potri.006G268450.1.p locus=Potri.006G268450 ID=Potri.006G268450.1.v4.1 annot-version=v4.1 MIMKKYSLNPVLSSFFFLSLMILFSEMGVAQNTTSTIPVNVGVVLDLASLEANIALSCINMALSDFYASHGDYKTRLVLNTRDSKKDVIGAAAAALDLIK NVEVQAILGPTTSMQANFVIDLGEKAHVPIISFSATSPSLTSIGSSYFLRATQNDSAQVNAISAIVQAFGWKEAVPIYIDNEYGEGIIPYLTDALHVVDA RVPYRSVISPSATDVQIVEELNKLMTMLGYCHLVAIPHH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G27100		ATGLR2.1	ARABIDOPSIS THALIANA GLUTAMATE...		Potri.006G268450 [exp]	0	1
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Potri.006G268500 [exp]	1.00	0.9943
AT3G50930		BCS1	cytochrome BC1 synthesis (.1)		Potri.007G020900 [exp]	5.47	0.9171
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Potri.006G268400 [exp]	6.00	0.9358
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Potri.011G028500 [exp]	6.92	0.9234
AT1G53670		MSRB1, ATMSRB1	methionine sulfoxide reductase...		Potri.011G114300 [exp]	8.71	0.9213
AT4G23990		ATCSLG3	ARABIDOPSIS THALIANA CELLULOSE...		Potri.003G142301 [exp]	14.31	0.9208
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Potri.006G270400 [exp]	16.58	0.9022
AT5G22830		MRS2-11, GMN10,...	MAGNESIUM TRANSPORTER 10, magn...		Potri.009G151400 [exp]	18.49	0.9044	ATMGT10.1
AT5G35970			P-loop containing nucleoside t...		Potri.013G073900 [exp]	22.44	0.8971
AT1G76430		PHT1;9	phosphate transporter 1;9 (.1)		Potri.005G256100 [exp]	28.86	0.8949	11

Compare expression of checked genes

Potri.006G268450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.