Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51600 186 / 1e-56 ATMAP65-3, PLE PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) AT3G60840 182 / 3e-55 MAP65-4 microtubule-associated protein 65-4 (.1) AT5G62250 164 / 4e-49 MAP65-9 microtubule-associated protein 65-9 (.1) AT4G26760 163 / 1e-48 MAP65-2 microtubule-associated protein 65-2 (.1) AT2G01910 152 / 1e-44 ATMAP65-6 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2) AT5G55230 152 / 2e-44 ATMAP65-1 microtubule-associated proteins 65-1 (.1.2) AT1G14690 152 / 3e-44 MAP65-7 microtubule-associated protein 65-7 (.1.2) AT1G27920 124 / 2e-34 MAP65-8 microtubule-associated protein 65-8 (.1) AT2G38720 105 / 2e-27 MAP65-5 microtubule-associated protein 65-5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G057150 [exp] 211 / 8e-72 AT5G51600 181 / 1e-54 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Potri.015G131400 [exp] 223 / 4e-70 AT5G51600 728 / 0.0 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Potri.012G129600 [exp] 213 / 3e-66 AT5G51600 761 / 0.0 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Potri.014G070100 [exp] 179 / 1e-53 AT5G51600 451 / 5e-149 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Potri.011G092500 [exp] 167 / 3e-50 AT5G55230 863 / 0.0 microtubule-associated proteins 65-1 (.1.2) Potri.001G356500 [exp] 155 / 1e-45 AT5G55230 853 / 0.0 microtubule-associated proteins 65-1 (.1.2) Potri.008G139700 [exp] 155 / 2e-45 AT2G01910 778 / 0.0 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2) Potri.001G055100 [exp] 136 / 1e-38 AT1G27920 623 / 0.0 microtubule-associated protein 65-8 (.1) Potri.003G192400 [exp] 134 / 5e-38 AT2G38720 555 / 0.0 microtubule-associated protein 65-5 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015684 [exp] 208 / 1e-64 AT5G51600 759 / 0.0 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Lus10037691 [exp] 207 / 3e-64 AT5G51600 768 / 0.0 PLEIADE, ARABIDOPSIS THALIANA MICROTUBULE-ASSOCIATED PROTEIN 65-3, Microtubule associated protein (MAP65/ASE1) family protein (.1) Lus10032567 [exp] 158 / 3e-46 AT5G55230 850 / 0.0 microtubule-associated proteins 65-1 (.1.2) Lus10043178 [exp] 158 / 4e-46 AT5G55230 847 / 0.0 microtubule-associated proteins 65-1 (.1.2) Lus10031939 [exp] 146 / 3e-42 AT2G01910 838 / 0.0 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2) Lus10035099 [exp] 141 / 2e-40 AT2G01910 822 / 0.0 Microtubule associated protein (MAP65/ASE1) family protein (.1), Microtubule associated protein (MAP65/ASE1) family protein (.2) Lus10008705 [exp] 136 / 1e-38 AT2G38720 565 / 0.0 microtubule-associated protein 65-5 (.1) Lus10015789 [exp] 132 / 4e-37 AT1G27920 673 / 0.0 microtubule-associated protein 65-8 (.1) Lus10026114 [exp] 132 / 5e-37 AT2G38720 553 / 0.0 microtubule-associated protein 65-5 (.1) Lus10041635 [exp] 117 / 2e-31 AT2G38720 550 / 0.0 microtubule-associated protein 65-5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03999 [poplar] [flax] MAP65_ASE1 Microtubule associated protein (MAP65/ASE1 family)
Representative CDS sequence Show only first row Show all	>Potri.006G269800.1 pacid=42767661 polypeptide=Potri.006G269800.1.p locus=Potri.006G269800 ID=Potri.006G269800.1.v4.1 annot-version=v4.1 ATGGACCCTGCGAGTATACTTGAGCAGATTAAGCTTCAAATTGCTAATGTTAAGGAGGAATCTTTTAGCAGGAAAGAAATACTTGAAAGGGTTGAGAAAT GGTTGACTGCATGTGAAGAGGAGAGTTGGCTTGAGGAATATAACAGGGATGACAATCGATACAATGCTGGGAGAGATGCTCATCTAACTCTCAAGCGTGC TGAGAAAGCTCGCAATTTGGTTAATAAAATGCCAGGTATGGTGGAGGCTTTGGCTTCCAAAACCATGACATGGGAAATCGAGAGAGACACTGAATTCTTA TATGATGGTATCTGCCTTCTTTCTATGCTTGAAGAGTACACCATATTACGCCAGGAGAAACAGGAAGAAAGACGAAGTTAG
AA sequence Show only first row Show all	>Potri.006G269800.1 pacid=42767661 polypeptide=Potri.006G269800.1.p locus=Potri.006G269800 ID=Potri.006G269800.1.v4.1 annot-version=v4.1 MDPASILEQIKLQIANVKEESFSRKEILERVEKWLTACEEESWLEEYNRDDNRYNAGRDAHLTLKRAEKARNLVNKMPGMVEALASKTMTWEIERDTEFL YDGICLLSMLEEYTILRQEKQEERRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G51600		ATMAP65-3, PLE	PLEIADE, ARABIDOPSIS THALIANA ...		Potri.006G269800 [exp]	0	1
					Potri.001G020080 [exp]	1.00	0.9342
AT2G06255		ELF4-L3	ELF4-like 3 (.1)		Potri.019G131700 [exp]	3.46	0.8743
AT1G14685	BBR_BPC	BBR/BPC2, ATBPC...	basic pentacysteine 2 (.1.2.3)		Potri.012G040800 [exp]	3.46	0.8898
					Potri.004G133550 [exp]	6.16	0.8434
AT1G15950		IRX4, ATCCR1, C...	IRREGULAR XYLEM 4, cinnamoyl c...		Potri.001G045100 [exp]	8.48	0.8786
AT1G49330			hydroxyproline-rich glycoprote...		Potri.009G113900 [exp]	10.67	0.8005
AT2G37520			Acyl-CoA N-acyltransferase wit...		Potri.009G016832 [exp]	12.88	0.7757
					Potri.013G160350 [exp]	13.41	0.8451
AT4G19610			nucleotide binding;nucleic aci...		Potri.001G081000 [exp]	15.19	0.8832
AT4G02550			unknown protein		Potri.006G191850 [exp]	15.39	0.8159

Compare expression of checked genes

Potri.006G269800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.