Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 146 / 5e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72860 139 / 2e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72920 129 / 3e-36 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G27170 134 / 6e-36 transmembrane receptors;ATP binding (.1.2) AT1G72890 131 / 1e-35 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G17615 129 / 3e-35 Disease resistance protein (TIR-NBS class) (.1) AT1G72930 123 / 4e-35 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72940 128 / 6e-35 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72910 127 / 7e-35 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72900 126 / 2e-34 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G282900 [exp] 387 / 6e-132 AT5G36930 361 / 1e-110 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G012475 [exp] 395 / 2e-130 AT5G36930 431 / 1e-131 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G012000 [exp] 390 / 1e-128 AT5G36930 489 / 2e-153 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008228 [exp] 372 / 9e-124 AT5G36930 468 / 3e-148 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008612 [exp] 373 / 7e-122 AT5G36930 467 / 6e-145 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283800 [exp] 352 / 9e-121 AT5G36930 286 / 1e-85 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008292 [exp] 365 / 4e-119 AT5G36930 454 / 2e-140 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008868 [exp] 364 / 6e-119 AT5G36930 471 / 1e-146 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283500 [exp] 333 / 8e-115 AT5G36930 235 / 8e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005171 [exp] 197 / 2e-57 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10018972 [exp] 186 / 2e-54 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011741 [exp] 184 / 3e-53 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014582 [exp] 154 / 2e-45 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10032101 [exp] 153 / 8e-44 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10015453 [exp] 153 / 1e-43 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10039850 [exp] 150 / 2e-41 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011104 [exp] 148 / 1e-40 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10018616 [exp] 147 / 3e-40 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007790 [exp] 139 / 3e-37 AT5G36930 343 / 4e-99 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.006G269950.1 pacid=42767285 polypeptide=Potri.006G269950.1.p locus=Potri.006G269950 ID=Potri.006G269950.1.v4.1 annot-version=v4.1 ATGGCTGCTGGGAAGTATCAAGAATCCTACTCTTCACGGTTTCCTAATTGTAAATATCAAGTGTTCTTGAGTTTTAGAGGTGAAGACACCCGCAAGAACT TTACCGATCACCTCTACACGGCCCTGGTTCAAGCAGGGATTCACACATTTAGAGATGATAATGAAATTCGGAGAGGAGAGAATATAGATTTCGAGCTCCA GAAGGCAATACAACAATCAAAAATATCGATAATCGTGTTCTCCAAAGACTATGCTTCGTCGAGATGGTGCCTCGATGAACTTGTAATGATCATGGAACGT AAGAGGAATGCTGACTGCATAGTTTTGCCAATATTCTATGATGTGGATCCATCCCAAGTCGGACGTCAAACAGGGAGCTTCTCTGCAGCATTTGTGGAAC ATGAAAAGAGCTTCAACAAGGAGATGGAGCGGGTGAATGGGTGGAGGATTGCTTTAAAGGAAGTGGCTGATTTAGCTGGAATGGTTCTAGGAGATGGGTG CGAGGCACCGTTTGTCCAATCTATTGTGGAGAATATCTCAAAGAATTTGGATCAAAAAATGTTTCATGTACCCCCTCATTTCATTGGAAGAGATCCTCTA GTACAAGATATCAACTCATGGTTGCAAGATGTATCCTGTTGTAACCCATTTTTGGATCCCTATAAAAATAAAAAAATAAAAAGAAAAAAAGAAAACACCT CAAAATAG
AA sequence Show only first row Show all	>Potri.006G269950.1 pacid=42767285 polypeptide=Potri.006G269950.1.p locus=Potri.006G269950 ID=Potri.006G269950.1.v4.1 annot-version=v4.1 MAAGKYQESYSSRFPNCKYQVFLSFRGEDTRKNFTDHLYTALVQAGIHTFRDDNEIRRGENIDFELQKAIQQSKISIIVFSKDYASSRWCLDELVMIMER KRNADCIVLPIFYDVDPSQVGRQTGSFSAAFVEHEKSFNKEMERVNGWRIALKEVADLAGMVLGDGCEAPFVQSIVENISKNLDQKMFHVPPHFIGRDPL VQDINSWLQDVSCCNPFLDPYKNKKIKRKKENTSK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.006G269950 [exp]	0	1
AT2G32235			unknown protein		Potri.018G147100 [exp]	4.24	0.9350
					Potri.001G141701 [exp]	6.32	0.9243
AT1G73440			calmodulin-related (.1)		Potri.014G060700 [exp]	8.77	0.8838
AT4G30130			Protein of unknown function (D...		Potri.018G147749 [exp]	9.48	0.9404
					Potri.014G065700 [exp]	10.58	0.9365
AT1G06170	bHLH	bHLH149	basic helix-loop-helix (bHLH) ...		Potri.009G023800 [exp]	11.57	0.8898
AT2G26470			unknown protein		Potri.002G250400 [exp]	12.24	0.8994
AT5G47310			PPPDE putative thiol peptidase...		Potri.001G154400 [exp]	15.68	0.8535
AT4G31730		ATGDU1, GDU1	glutamine dumper 1 (.1)		Potri.017G107400 [exp]	17.32	0.8688
					Potri.006G002401 [exp]	22.91	0.8633

Compare expression of checked genes

Potri.006G269950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.