Plant FIBer expression Database

Potri.006G270501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20060 47 / 1e-07 Ribosomal protein L4/L1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G004800
[exp]
135 / 6e-41 AT2G20060 465 / 1e-166 Ribosomal protein L4/L1 family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005427
[exp]
48 / 7e-08 AT2G20060 390 / 3e-138 Ribosomal protein L4/L1 family (.1)
PFAM info
Representative CDS sequence
>Potri.006G270501.1 pacid=42769588 polypeptide=Potri.006G270501.1.p locus=Potri.006G270501 ID=Potri.006G270501.1.v4.1 annot-version=v4.1
ATGTTTTTGATTTCCCTATCAGGAATGATATTATTCACCGTGTCGTGTGATGGCAGCTTGCAAAACAACAATAGGGAGCACATTCAACTAAAACAATCAG
TGAGGTTAGTGGGACTGGAAGAAAGCCATATAGACAAAAGAGCACTGGCCGAGCAAGGTATGGAACGCTGTGTTGGCCCCAGTTTAGAGGTGGTGCTGTT
ATGCATGGTCCTAAACCACAAAGTCATGCTATTGAATTAA
AA sequence
>Potri.006G270501.1 pacid=42769588 polypeptide=Potri.006G270501.1.p locus=Potri.006G270501 ID=Potri.006G270501.1.v4.1 annot-version=v4.1
MFLISLSGMILFTVSCDGSLQNNNREHIQLKQSVRLVGLEESHIDKRALAEQGMERCVGPSLEVVLLCMVLNHKVMLLN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G20060 Ribosomal protein L4/L1 family... Potri.006G270501
[exp]
0 1
Potri.008G017550
[exp]
23.55 0.7270
AT5G36930 Disease resistance protein (TI... Potri.011G008228
[exp]
27.49 0.8406
AT5G36930 Disease resistance protein (TI... Potri.011G009251
[exp]
35.70 0.8342
AT1G03180 unknown protein Potri.002G053801
[exp]
40.89 0.7730
Potri.017G020266
[exp]
45.11 0.7027
AT5G04760 MYB Duplicated homeodomain-like su... Potri.008G016175
[exp]
50.10 0.7805
AT5G36930 Disease resistance protein (TI... Potri.011G015400
[exp]
52.30 0.8005
AT2G25770 Polyketide cyclase/dehydrase a... Potri.018G046100
[exp]
78.80 0.7930
AT1G61415 unknown protein Potri.015G049800
[exp]
92.46 0.7693
AT5G44870 TTR1, LAZ5 tolerance to Tobacco ringspot ... Potri.006G282700
[exp]
103.06 0.7658

Potri.006G270501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.