Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24490 73 / 3e-17 ATRPA32A, RPA2, ATRPA2, ROR1 SUPPRESSOR OF ROS1, replicon protein A2 (.1.2) AT3G02920 50 / 1e-08 ATRPA32B Replication protein A, subunit RPA32 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G275700 [exp] 147 / 6e-46 AT2G24490 251 / 3e-83 SUPPRESSOR OF ROS1, replicon protein A2 (.1.2) Potri.018G091700 [exp] 57 / 2e-11 AT3G02920 246 / 3e-81 Replication protein A, subunit RPA32 (.1.2) Potri.006G167600 [exp] 56 / 7e-11 AT3G02920 219 / 9e-71 Replication protein A, subunit RPA32 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026954 [exp] 120 / 3e-35 AT2G24490 252 / 7e-84 SUPPRESSOR OF ROS1, replicon protein A2 (.1.2) Lus10020154 [exp] 104 / 4e-29 AT2G24490 243 / 3e-80 SUPPRESSOR OF ROS1, replicon protein A2 (.1.2) Lus10026953 [exp] 55 / 2e-10 AT5G10630 327 / 1e-104 Translation elongation factor EF1A/initiation factor IF2gamma family protein (.1.2) Lus10019976 [exp] 54 / 6e-10 AT3G02920 258 / 8e-86 Replication protein A, subunit RPA32 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF08784 [poplar] [flax] RPA_C Replication protein A C terminal
Representative CDS sequence Show only first row Show all	>Potri.006G272000.4 pacid=42767013 polypeptide=Potri.006G272000.4.p locus=Potri.006G272000 ID=Potri.006G272000.4.v4.1 annot-version=v4.1 ATGTCCAAGCAATTTGATGTTAATGGGCTAAAGGATTGTGATCAATTGGTCCTTGAGCGTCTGCAACAGTCTTCAAGCATTGGGCAGGAAAAAGGGATGC CCATGGATGAACTTTGCCAACAGCTGAAACTTCCCATGGAGAAGATCAAGGAATCTATCAGATCACTTGAGGATGAAGGTTTAATATACTCTACAATTGA CGAGTTTCACTACAAAGCAACCTGA
AA sequence Show only first row Show all	>Potri.006G272000.4 pacid=42767013 polypeptide=Potri.006G272000.4.p locus=Potri.006G272000 ID=Potri.006G272000.4.v4.1 annot-version=v4.1 MSKQFDVNGLKDCDQLVLERLQQSSSIGQEKGMPMDELCQQLKLPMEKIKESIRSLEDEGLIYSTIDEFHYKAT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G24490		ATRPA32A, RPA2,...	SUPPRESSOR OF ROS1, replicon p...		Potri.006G272000 [exp]	0	1
AT5G27820			Ribosomal L18p/L5e family prot...		Potri.005G068300 [exp]	1.41	0.6505
AT1G57775			Protein of unknown function (D...		Potri.004G115201 [exp]	3.74	0.6886
AT1G57775			Protein of unknown function (D...		Potri.004G115150 [exp]	10.95	0.6263
					Potri.018G031250 [exp]	11.22	0.6398
AT5G04390	C2H2ZnF		C2H2-type zinc finger family p...		Potri.006G121600 [exp]	18.16	0.5905
AT1G57775			Protein of unknown function (D...		Potri.004G115100 [exp]	26.83	0.5482
					Potri.005G133550 [exp]	36.72	0.5188
					Potri.005G043600 [exp]	68.27	0.5254
AT4G00755			F-box family protein (.1.2)		Potri.014G076200 [exp]	72.41	0.4901
AT3G47570			Leucine-rich repeat protein ki...		Potri.016G029900 [exp]	78.51	0.5064

Compare expression of checked genes

Potri.006G272000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.