Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44870 59 / 1e-09 TTR1, LAZ5 tolerance to Tobacco ringspot virus 1, LAZARUS 5, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G40100 56 / 9e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63870 55 / 2e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G12010 55 / 3e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G11250 54 / 3e-08 Disease resistance protein (TIR-NBS-LRR class) (.1) AT4G19530 54 / 3e-08 disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G45200 54 / 6e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63860 53 / 1e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G65850 52 / 1e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G19510 52 / 2e-07 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G283600 [exp] 482 / 2e-172 AT5G36930 140 / 1e-35 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008612 [exp] 359 / 2e-116 AT5G36930 467 / 6e-145 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G015400 [exp] 358 / 2e-116 AT5G36930 438 / 1e-134 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G013450 [exp] 355 / 5e-116 AT5G36930 422 / 2e-129 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283700 [exp] 336 / 4e-115 AT5G40100 66 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.006G282800 [exp] 334 / 1e-114 AT5G40100 67 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.006G283400 [exp] 336 / 2e-114 AT5G36930 144 / 9e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G012750 [exp] 340 / 2e-113 AT5G36930 195 / 3e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G270000 [exp] 350 / 5e-113 AT5G36930 496 / 1e-155 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005171 [exp] 69 / 5e-13 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10011741 [exp] 59 / 1e-09 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10015649 [exp] 46 / 6e-06 AT1G69550 75 / 1e-15 disease resistance protein (TIR-NBS-LRR class) (.1) Lus10003749 [exp] 47 / 7e-06 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10029722 [exp] 47 / 1e-05 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10030839 [exp] 46 / 2e-05 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10039850 [exp] 46 / 2e-05 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10028043 [exp] 45 / 3e-05 AT5G17680 59 / 4e-09 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10016029 [exp] 45 / 3e-05 AT4G12010 451 / 2e-138 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10012247 [exp] 45 / 4e-05 AT5G45230 92 / 2e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G282700.1 pacid=42770014 polypeptide=Potri.006G282700.1.p locus=Potri.006G282700 ID=Potri.006G282700.1.v4.1 annot-version=v4.1 ATGGAGCTTCCAGAAGAATTGAGTAGATTCAATTCACTTCAAGAGCTGGTTTTAGATGGTTGCTCAAATCTTGACAGCATGAATATGGAGTTAGAGCATC ATCAAGGGCGCAAGTTGCTTCAAAGTGATGGAATTGTTGCAAGTGCATCATACATTACATCTCTTCCGTTGAAGCTATTCTTTCCCTCTAGGTTTTCAGC GAGGAAAATGTTGAGATTTACCTTGTTTTCACTGCCACGCTTCTTGGAGAGTCTAGATTTAAGTGGAACTCCAATTCGTTTTTTTCCAGAAAGCATCAAG GATCTTGGTCTGCTCAGAGTTTTGATTTTAAGAAATTGCAAAATGCTTCAGGCACTCCCAGAGCTTCCATCCCATTTGGATTCGTTAGATGTGTCCTTTT GCTATTCACTGCAAAGCCTTGCAAATCGACACCGTTGGATTTTAGCAGATGGTTGTGATCACTTAGCCGAGTTCCAAGATCGGATAAAGCAAGAATTAAT CCAAAAGTTTGACTCTCACATGTTCAGAATAATGGAAACGGTTTGTGCTCAAATACAGACATCGAGATTTGAGGTATTATTTGATCATGGCAAATTCAAC GTATATGTATTTGATGAAGATGAGGAGTTAAGGGTGTTTTATGAGGAGGAAGAAGAGGATAAATGGCTAATTCAGAATGAGTTTGTAGATATAACTTTTC ATTCAAAATATCCTCACCTGGGACGCTCCGGATATGTGGATTTAATTTGTTCACAAGGTGTTGTATGA
AA sequence Show only first row Show all	>Potri.006G282700.1 pacid=42770014 polypeptide=Potri.006G282700.1.p locus=Potri.006G282700 ID=Potri.006G282700.1.v4.1 annot-version=v4.1 MELPEELSRFNSLQELVLDGCSNLDSMNMELEHHQGRKLLQSDGIVASASYITSLPLKLFFPSRFSARKMLRFTLFSLPRFLESLDLSGTPIRFFPESIK DLGLLRVLILRNCKMLQALPELPSHLDSLDVSFCYSLQSLANRHRWILADGCDHLAEFQDRIKQELIQKFDSHMFRIMETVCAQIQTSRFEVLFDHGKFN VYVFDEDEELRVFYEEEEEDKWLIQNEFVDITFHSKYPHLGRSGYVDLICSQGVV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G44870		TTR1, LAZ5	tolerance to Tobacco ringspot ...		Potri.006G282700 [exp]	0	1
AT4G27220			NB-ARC domain-containing disea...		Potri.018G145566 [exp]	1.41	0.9528
AT4G27190			NB-ARC domain-containing disea...		Potri.018G136700 [exp]	2.00	0.9474
AT4G27220			NB-ARC domain-containing disea...		Potri.018G145572 [exp]	3.46	0.9355
AT3G14470			NB-ARC domain-containing disea...		Potri.017G014900 [exp]	4.24	0.9369
AT5G36930			Disease resistance protein (TI...		Potri.011G077260 [exp]	4.47	0.8897
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Potri.004G174150 [exp]	8.30	0.8345
AT5G36930			Disease resistance protein (TI...		Potri.011G015400 [exp]	11.22	0.9030
AT3G14470			NB-ARC domain-containing disea...		Potri.017G127651 [exp]	11.61	0.9110
AT5G36930			Disease resistance protein (TI...		Potri.011G008740 [exp]	12.24	0.8476
AT5G36930			Disease resistance protein (TI...		Potri.019G017082 [exp]	13.03	0.9092

Compare expression of checked genes

Potri.006G282700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.