Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 144 / 2e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G27180 85 / 8e-19 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G65850 84 / 2e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G25510 84 / 2e-18 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G27170 82 / 5e-18 transmembrane receptors;ATP binding (.1.2) AT5G38340 82 / 8e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT2G16870 78 / 2e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G46260 72 / 1e-14 disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G69550 72 / 3e-14 disease resistance protein (TIR-NBS-LRR class) (.1) AT5G38350 71 / 6e-14 Disease resistance protein (NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G014101 [exp] 391 / 4e-133 AT5G36930 435 / 1e-137 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G282200 [exp] 400 / 1e-132 AT5G36930 454 / 2e-140 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G013450 [exp] 397 / 3e-132 AT5G36930 422 / 2e-129 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G012750 [exp] 387 / 3e-132 AT5G36930 195 / 3e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G013900 [exp] 398 / 5e-132 AT5G36930 441 / 1e-135 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G011600 [exp] 397 / 2e-131 AT5G36930 492 / 1e-154 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G269900 [exp] 387 / 1e-130 AT5G36930 284 / 2e-81 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G283000 [exp] 392 / 7e-130 AT5G36930 460 / 8e-143 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.011G008612 [exp] 388 / 6e-128 AT5G36930 467 / 6e-145 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033825 [exp] 160 / 3e-45 AT5G36930 400 / 3e-123 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005171 [exp] 160 / 4e-45 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10011741 [exp] 150 / 1e-41 AT5G36930 540 / 4e-172 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10039850 [exp] 121 / 2e-31 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018616 [exp] 116 / 1e-29 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10003749 [exp] 104 / 2e-25 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10011104 [exp] 101 / 2e-24 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10030839 [exp] 81 / 2e-17 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10018972 [exp] 79 / 6e-17 AT5G36930 192 / 3e-51 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014207 [exp] 77 / 6e-16 AT5G36930 446 / 5e-135 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G284100.1 pacid=42770072 polypeptide=Potri.006G284100.1.p locus=Potri.006G284100 ID=Potri.006G284100.1.v4.1 annot-version=v4.1 ATGCATCAACTAGTAAGAGATATGGGAAGGGAAATTGCTCGTCAAGAATCACCCAAATGTCAAAGAATATGTCATCATGGAGATGCTTTTACAGTTTTGA AAGGAACTACTCGCCGCAGGCTTAACTTCTTTCAACAATGGCTTTCCGATTTTTTCGATGGGGGAAAATTACAAACTGGCCAAACAAGTTTGTTTCCCAT CCTCAACACGGATGCTTTTAGAAAGATGCCAGATGTAAAATTTCTCCAACTAAACTACACTAATTTTCATGGAAGTTTTGAGCACTTTCCCAAGAATTTG ATATGGTTATGTTGGCATGGATTGTCTTGGAGCTCCATACCAAATCACGTATGCTTGGAGAAGCTGGTGGTTCTTGATCTATCCAGAAGTTGTCTAGTTG ATGCTTGGAAGGGCAAACCGTTTCTTCCAAAATTGAAAATTCTTGATCTCCGTCACTCTCGTGATCTCATTAGAACTCCAGACTTCTCGGGTCTCCCAGC CCTTGAAAAGCTAATACTTGAAGACTGCATCTGTTTGGTTCAATTTCACGAATCTATTGGTAATTTACAAAGATTGTTGATCTTAAATCTAAGAAATTGT ACTAGTCTTGTGGAGCTTCCAGAAGAAATGAGTAGATTGAATTCACTTCAAGAGCTGGTTTTAGATCATTAG
AA sequence Show only first row Show all	>Potri.006G284100.1 pacid=42770072 polypeptide=Potri.006G284100.1.p locus=Potri.006G284100 ID=Potri.006G284100.1.v4.1 annot-version=v4.1 MHQLVRDMGREIARQESPKCQRICHHGDAFTVLKGTTRRRLNFFQQWLSDFFDGGKLQTGQTSLFPILNTDAFRKMPDVKFLQLNYTNFHGSFEHFPKNL IWLCWHGLSWSSIPNHVCLEKLVVLDLSRSCLVDAWKGKPFLPKLKILDLRHSRDLIRTPDFSGLPALEKLILEDCICLVQFHESIGNLQRLLILNLRNC TSLVELPEEMSRLNSLQELVLDH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36930			Disease resistance protein (TI...		Potri.006G284100 [exp]	0	1
					Potri.003G026106 [exp]	2.00	0.8311
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Potri.007G050000 [exp]	9.05	0.8150
AT5G51950			Glucose-methanol-choline (GMC)...		Potri.012G135200 [exp]	9.21	0.7488
AT4G13460		SET22, SDG22, S...	SETDOMAIN GROUP 22, SU(VAR)3-9...		Potri.010G064300 [exp]	12.00	0.7747
AT5G65170			VQ motif-containing protein (....		Potri.005G076600 [exp]	17.97	0.7456
					Potri.002G239451 [exp]	18.65	0.7911
AT1G71010		FAB1C	FORMS APLOID AND BINUCLEATE CE...		Potri.010G113700 [exp]	18.76	0.6962
AT4G08850			Leucine-rich repeat receptor-l...		Potri.019G129300 [exp]	21.00	0.7881
					Potri.005G162201 [exp]	28.28	0.7710
AT5G09970		CYP78A7	"cytochrome P450, family 78, s...		Potri.005G200400 [exp]	28.49	0.7234

Compare expression of checked genes

Potri.006G284100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.