Potri.007G005100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G67590 214 / 2e-72 FRO1 FROSTBITE1, NADH-ubiquinone oxidoreductase-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G117800 212 / 1e-71 AT5G67590 198 / 4e-66 FROSTBITE1, NADH-ubiquinone oxidoreductase-related (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011547 232 / 3e-79 AT5G67590 213 / 7e-72 FROSTBITE1, NADH-ubiquinone oxidoreductase-related (.1)
Lus10019261 228 / 8e-78 AT5G67590 211 / 4e-71 FROSTBITE1, NADH-ubiquinone oxidoreductase-related (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04800 ETC_C1_NDUFA4 ETC complex I subunit conserved region
Representative CDS sequence
>Potri.007G005100.1 pacid=42765224 polypeptide=Potri.007G005100.1.p locus=Potri.007G005100 ID=Potri.007G005100.1.v4.1 annot-version=v4.1
ATGTCGAGTTCTCTGCCAAAAATCTGGAAAAATGGTTGCGCCCTTCGAGCAAGCAGCATAGGCCCATTATGGAGGAGGCCGTTCTCCGCTTCTTCCGATG
CATTGGTAGAGTACAAAGCTGGGGAGATCGGCATGGTCTCTGGCATCCCCCAAGACCACCTTCGCAGGAGAGTTGTCATTTACTCACCTGCTAGAACTTC
AACCCAACAAGGATCTGGAAAAGTTGGAAGGTGGAAAATCAATTTTATGTCAACACTAAAGTGGGAGAATCCATTGATGGGGTGGACATCTACAGGGGAT
CCATATGCCCATGTGGGTGATTCTGCACTCGGTTTTGACAGTGAAGAAGCTGCAAAGGCATTTGCTGAGCGTCATGGTTGGGAGTATGTGGTTAAAAAGC
GCCACACACCGCTATTGAAGGTTAAGGCATATGCAGACAACTTCAAATTCAAGGGGCATCCCAAGACTGATGACAAATAA
AA sequence
>Potri.007G005100.1 pacid=42765224 polypeptide=Potri.007G005100.1.p locus=Potri.007G005100 ID=Potri.007G005100.1.v4.1 annot-version=v4.1
MSSSLPKIWKNGCALRASSIGPLWRRPFSASSDALVEYKAGEIGMVSGIPQDHLRRRVVIYSPARTSTQQGSGKVGRWKINFMSTLKWENPLMGWTSTGD
PYAHVGDSALGFDSEEAAKAFAERHGWEYVVKKRHTPLLKVKAYADNFKFKGHPKTDDK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G67590 FRO1 FROSTBITE1, NADH-ubiquinone ox... Potri.007G005100 0 1
AT2G25310 Protein of unknown function (D... Potri.018G024600 2.64 0.8973
AT1G07960 ATPDIL5-1 PDI-like 5-1 (.1.2.3) Potri.009G004500 3.00 0.8944
AT4G11150 TUFF, EMB2448, ... embryo defective 2448, vacuola... Potri.013G051500 4.24 0.9196
AT1G67785 unknown protein Potri.015G087301 6.48 0.9006
AT2G27020 PAG1 20S proteasome alpha subunit G... Potri.009G020800 8.00 0.9119 PAG1.2
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Potri.008G155500 8.36 0.9007 Pt-PBD2.3
AT4G37830 cytochrome c oxidase-related (... Potri.007G008800 8.83 0.9104
AT3G03070 NADH-ubiquinone oxidoreductase... Potri.013G082100 10.48 0.8734
AT3G04780 Protein of unknown function (D... Potri.013G039500 10.95 0.9024
AT4G34720 ATVHA-C1, AVA-P... VACUOLAR H+-PUMPING ATPASE C1,... Potri.009G125000 12.72 0.8697 Pt-AVAP5.2

Potri.007G005100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.