Potri.007G006100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58420 68 / 2e-14 Uncharacterised conserved protein UCP031279 (.1)
AT4G37700 57 / 1e-10 unknown protein
AT1G10140 56 / 5e-10 Uncharacterised conserved protein UCP031279 (.1)
AT5G65925 45 / 2e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G006300 205 / 1e-68 AT1G58420 56 / 3e-10 Uncharacterised conserved protein UCP031279 (.1)
Potri.014G014600 92 / 8e-24 AT1G58420 87 / 4e-22 Uncharacterised conserved protein UCP031279 (.1)
Potri.002G117100 89 / 8e-23 AT1G58420 84 / 1e-20 Uncharacterised conserved protein UCP031279 (.1)
Potri.014G014500 74 / 4e-17 AT1G58420 81 / 9e-20 Uncharacterised conserved protein UCP031279 (.1)
Potri.009G086000 62 / 2e-12 ND /
Potri.001G290400 54 / 2e-09 ND /
Potri.009G085900 51 / 3e-08 ND /
Potri.001G290300 48 / 3e-07 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025207 73 / 2e-16 AT4G37700 56 / 4e-10 unknown protein
Lus10011553 69 / 2e-15 ND 49 / 4e-08
Lus10018665 58 / 1e-10 AT1G10140 89 / 2e-22 Uncharacterised conserved protein UCP031279 (.1)
Lus10011707 53 / 4e-09 AT4G37700 45 / 2e-06 unknown protein
Lus10007729 53 / 9e-09 AT1G10140 82 / 1e-19 Uncharacterised conserved protein UCP031279 (.1)
Lus10012496 50 / 9e-08 AT1G58420 86 / 4e-21 Uncharacterised conserved protein UCP031279 (.1)
PFAM info
Representative CDS sequence
>Potri.007G006100.1 pacid=42766275 polypeptide=Potri.007G006100.1.p locus=Potri.007G006100 ID=Potri.007G006100.1.v4.1 annot-version=v4.1
ATGGCTACCAGTAAGAAGCCTAGCAAAGAGAGCAAACTGAAAAGGATTCTGAAGGTGCCCCTCAAGATTTTGACCAGCGCCAGGGACTTCTACATGAAAG
GCATGACTGAATACTCAGACCAGGTTTATGTGATGAGTAACCCTACAGGAAATCTTAATAACATGCCTCGCAGTTACAGTGTCAGCTCCTCAAAATCAAA
CCACTTCGATGATGATTACAGGGAGCTTATAAGGGCTGCATCCACAAGGAGTACTTTAGGACGTAGCAACAACATGGATGTTCGTGCAAGACAGCAATAT
ATTACTCGTGATAAAAAATCTGCAGCTGAAGTAGCAGACAATATGTCTAGGAGTCGTAGCGTTGCTATTGGAAGGATCGACGAAGAAACATCGACATGCG
ACTTTGATGAAGATCAGGATGTCAAGGCTAAGACTGGTCATGTTTATCCCAGAAGCAGAAGCTATGCTGTTTCTAAAAGAACTCCTACTAGGGCGTTTTA
A
AA sequence
>Potri.007G006100.1 pacid=42766275 polypeptide=Potri.007G006100.1.p locus=Potri.007G006100 ID=Potri.007G006100.1.v4.1 annot-version=v4.1
MATSKKPSKESKLKRILKVPLKILTSARDFYMKGMTEYSDQVYVMSNPTGNLNNMPRSYSVSSSKSNHFDDDYRELIRAASTRSTLGRSNNMDVRARQQY
ITRDKKSAAEVADNMSRSRSVAIGRIDEETSTCDFDEDQDVKAKTGHVYPRSRSYAVSKRTPTRAF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G58420 Uncharacterised conserved prot... Potri.007G006100 0 1
AT3G47570 Leucine-rich repeat protein ki... Potri.006G273001 2.64 0.9021
AT1G29860 WRKY ATWRKY71, WRKY7... WRKY DNA-binding protein 71 (.... Potri.001G352400 2.82 0.8839
AT5G38210 Protein kinase family protein ... Potri.017G118100 5.09 0.8870
AT5G61430 NAC ANAC100, ATNAC5 NAC domain containing protein ... Potri.012G001400 5.29 0.8677 NAC015
AT3G29400 ATEXO70E1 exocyst subunit exo70 family p... Potri.017G093700 6.48 0.8868
AT5G13330 AP2_ERF RAP2.6L related to AP2 6l (.1) Potri.003G162500 10.95 0.8734
AT4G31550 WRKY ATWRKY11, WRKY1... WRKY DNA-binding protein 11 (.... Potri.018G008500 11.83 0.8760 Pt-WRKY11.1
AT3G48520 CYP94B3 cytochrome P450, family 94, su... Potri.005G220700 12.00 0.8675 Pt-CYP94.7
AT3G26020 Protein phosphatase 2A regulat... Potri.008G179900 12.32 0.8418
AT4G06536 SPla/RYanodine receptor (SPRY)... Potri.014G025000 12.36 0.8622

Potri.007G006100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.