Potri.007G006200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22880 40 / 0.0002 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G006400 205 / 1e-67 AT4G37710 / VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019270 59 / 4e-11 AT4G37710 47 / 4e-07 VQ motif-containing protein (.1)
Lus10011555 59 / 5e-11 AT4G37710 47 / 2e-07 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.007G006200.1 pacid=42766580 polypeptide=Potri.007G006200.1.p locus=Potri.007G006200 ID=Potri.007G006200.1.v4.1 annot-version=v4.1
ATGGAAGCATATAATTCTTCTACTTCTTTAACGACATCCTCATCAATGTACTCGAAACAATACTCCGAGGAAACAAAAGGCCTGAAAATGCCACAATCTT
ACCATCTATCACTCCATTCCATTCGAAAACCCCAGATGAAACCATGTAAGAAACCAATAGCACCATTGCCACCAACGCCACCAAGAGTTTACAAGGTGGA
TCCTATAAACTTCCGAGACCTTGTTCAGAAGCTCACTGGTGCACCCGAGCCAGAGCCAGTGCCAGAGCCACAGCATCAGCCAAGGCTCCAAAGCGTGGCG
CCTCCTCCACTTGATCTTGCTAAACCAACATTATATGGTCGAGATTTTTCAGCAGTACCCTTACAACTCCTTCCTTCTCCTGCGAAAACCCCATTGTCTG
CCTTGTACCAGGAGTTAATGTCTGAGTCATTGGATGTAAAACCCAAGAAGATATCAGATAGTTTAATGGCCGTATCAAGTTCGCTCGAATTGAATCTGTC
ACCATCCTCTCGTGCTTGGTGTTCCTTTCCTCTTCTGAGTCCAGGAACTCTTTCCAGTCTTGAGCAAGGCACTGTGCTTTAG
AA sequence
>Potri.007G006200.1 pacid=42766580 polypeptide=Potri.007G006200.1.p locus=Potri.007G006200 ID=Potri.007G006200.1.v4.1 annot-version=v4.1
MEAYNSSTSLTTSSSMYSKQYSEETKGLKMPQSYHLSLHSIRKPQMKPCKKPIAPLPPTPPRVYKVDPINFRDLVQKLTGAPEPEPVPEPQHQPRLQSVA
PPPLDLAKPTLYGRDFSAVPLQLLPSPAKTPLSALYQELMSESLDVKPKKISDSLMAVSSSLELNLSPSSRAWCSFPLLSPGTLSSLEQGTVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G37710 VQ motif-containing protein (.... Potri.007G006200 0 1
AT4G05120 FUR1, ENT3, FLU... FUDR RESISTANT 1, EQUILIBRATIV... Potri.004G032400 1.00 0.9749
AT5G20260 Exostosin family protein (.1) Potri.006G064600 1.41 0.9733
AT1G68040 S-adenosyl-L-methionine-depend... Potri.008G136300 2.44 0.9729
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Potri.016G021500 3.16 0.9714
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Potri.019G125600 3.74 0.9666
AT5G07010 ATST2A ARABIDOPSIS THALIANA SULFOTRAN... Potri.003G188750 3.74 0.9514
AT2G43870 Pectin lyase-like superfamily ... Potri.007G144100 4.24 0.9690
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Potri.005G223300 4.89 0.9533
AT1G53130 GRI GRIM REAPER, Stigma-specific S... Potri.001G399200 5.74 0.9584
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Potri.016G022400 6.40 0.9281

Potri.007G006200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.