Potri.007G006300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22870 434 / 2e-154 EMB2001 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G11480 280 / 1e-93 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G58370 105 / 2e-25 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT1G08410 42 / 0.0004 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G27200 42 / 0.0004 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G243200 300 / 1e-101 AT5G11480 422 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.018G037000 290 / 9e-98 AT5G11480 421 / 7e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.014G006501 218 / 2e-72 AT2G22870 199 / 2e-65 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.014G007450 137 / 3e-41 AT2G22870 131 / 3e-39 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.019G128000 92 / 2e-20 AT5G58370 461 / 1e-158 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.007G021900 41 / 0.0006 AT5G66470 535 / 0.0 RNA binding;GTP binding (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039653 451 / 3e-161 AT2G22870 426 / 2e-151 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10011703 447 / 6e-160 AT2G22870 427 / 5e-152 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10022126 291 / 7e-98 AT5G11480 418 / 8e-148 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10011673 287 / 1e-96 AT5G11480 418 / 1e-147 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10009919 98 / 1e-22 AT5G58370 473 / 9e-165 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10021017 42 / 0.0005 AT1G52980 591 / 0.0 nuclear/nucleolar GTPase 2, GTP-binding family protein (.1)
Lus10023835 42 / 0.0005 AT1G52980 708 / 0.0 nuclear/nucleolar GTPase 2, GTP-binding family protein (.1)
Lus10004103 42 / 0.0006 AT1G08410 756 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10013359 42 / 0.0007 AT1G08410 745 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF01926 MMR_HSR1 50S ribosome-binding GTPase
Representative CDS sequence
>Potri.007G006300.1 pacid=42766791 polypeptide=Potri.007G006300.1.p locus=Potri.007G006300 ID=Potri.007G006300.1.v4.1 annot-version=v4.1
ATGCTACTACTTCGAAACCGCCTCTTCACTCTCTCATCGCTTCCCTCTCTAACTCAACACGCCAAAAACCATTTTCCGTTAACCTTCTCTTTCAATTACT
CGACCCGAGAACCTCCTAACCGAAACCCTTCCGGCCATGTCTCTGCTTCAAAGACATCGAAACCACCTCCACTCTCTGACGTGGCCCGGTTTGTCCGTAC
AGTTCTCTTTGTGCCACCCGGAGTTGACCCGGATAAAGTGACGGAGGAGATTATTTTGCCCGGCTCGAATATCGTTGTTGGACCTTATGCGGGTCATTCT
CAGATTAAGGAAGTTGAGTTTGTAAAAAGCAGTGGAAGGGCCAAGGATTGTCCGAGAGATGATCGACCTGAGTTTGCAATTTTGGGTCGGTCCAATGTGG
GAAAGTCTTCACTTATTAATGTTCTTGCTAGGAAGAAAGAAGTTGCTCTCACTTCGAAAAAACCAGGGAAGACCCAGTTGATAAATCATTTCTTGGTGAA
TAAAAGTTGGTACCTTGTGGATTTGCCTGGTTATGGGTTTGCTAAAGCCCCAGATTCTGCTCGAATGGATTGGTCGTCGTTTACAAAAGGCTACTTTTTA
AACAGAGAAACTCTGGTAGCTGTCCTACTTCTCATTGATGCTAGCGTCCCTCCTCAAAAGATTGACCTGGATTGTGCTAATTGGCTTGGACGCAACAATA
TACCAATGACATTAGTTTTCACTAAGTGTGACAAAATGAAGGGGGGAAAGAGAACAAGGCCTGATGAGAATATCAAGAATTTTCAAGAGTTAATGAGGCA
AAACTATCGGGAACATCCTGCATGGATCATGACTAGTAGTGTCACTGGTTTGGGCAGAGATGAGCTTCTCCTACACATGTCCCAGCTAAGAAACTACTGG
GATCAATAA
AA sequence
>Potri.007G006300.1 pacid=42766791 polypeptide=Potri.007G006300.1.p locus=Potri.007G006300 ID=Potri.007G006300.1.v4.1 annot-version=v4.1
MLLLRNRLFTLSSLPSLTQHAKNHFPLTFSFNYSTREPPNRNPSGHVSASKTSKPPPLSDVARFVRTVLFVPPGVDPDKVTEEIILPGSNIVVGPYAGHS
QIKEVEFVKSSGRAKDCPRDDRPEFAILGRSNVGKSSLINVLARKKEVALTSKKPGKTQLINHFLVNKSWYLVDLPGYGFAKAPDSARMDWSSFTKGYFL
NRETLVAVLLLIDASVPPQKIDLDCANWLGRNNIPMTLVFTKCDKMKGGKRTRPDENIKNFQELMRQNYREHPAWIMTSSVTGLGRDELLLHMSQLRNYW
DQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G22870 EMB2001 embryo defective 2001, P-loop ... Potri.007G006300 0 1
AT5G63050 EMB2759 embryo defective 2759 (.1.2) Potri.015G079700 5.65 0.9340
AT2G31190 WXR1, RUS2 weak auxin response1, ROOT UV-... Potri.005G224000 7.21 0.9196
AT5G62790 PDE129, DXR PIGMENT-DEFECTIVE EMBRYO 129, ... Potri.015G076200 10.00 0.8816 DXR.2
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Potri.006G110100 17.34 0.8956
AT1G31830 Amino acid permease family pro... Potri.003G103600 18.02 0.8871
AT3G54826 Zim17-type zinc finger protein... Potri.008G037300 19.07 0.9019
AT3G10670 ABCI6, ATNAP7 ATP-binding cassette I6, non-i... Potri.008G012500 21.30 0.9303 NAP7.2
AT3G28460 methyltransferases (.1) Potri.001G349800 22.97 0.9213
AT3G05675 BTB/POZ domain-containing prot... Potri.001G086100 25.86 0.8653
AT3G23100 XRCC4 homolog of human DNA ligase iv... Potri.010G075900 31.30 0.8637

Potri.007G006300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.