Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PSK3.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49780 61 / 1e-13 ATPSK3(FORMERSYMBOL), ATPSK3(FORMERSYMBOL), ATPSK4, ATPSK3(FORMERSYMBOL), ATPSK3(FORMERSYMBOL), ATP phytosulfokine 4 precursor (.1) AT5G65870 58 / 7e-13 ATPSK5 phytosulfokine 5 precursor (.1) AT2G22860 56 / 7e-12 ATPSK2 phytosulfokine 2 precursor (.1) AT4G37720 44 / 5e-07 ATPSK6, ATPSK4 phytosulfokine 6 precursor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G006900 [exp] 109 / 4e-33 AT2G22860 52 / 2e-10 phytosulfokine 2 precursor (.1) Potri.002G116300 [exp] 52 / 2e-10 AT2G22860 50 / 5e-10 phytosulfokine 2 precursor (.1) Potri.009G085600 [exp] 52 / 2e-10 AT3G49780 68 / 1e-16 phytosulfokine 4 precursor (.1) Potri.014G014000 [exp] 49 / 3e-09 AT3G49780 69 / 2e-17 phytosulfokine 4 precursor (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011721 [exp] 37 / 0.0003 AT3G49780 53 / 3e-10 phytosulfokine 4 precursor (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06404 [poplar] [flax] PSK Phytosulfokine precursor protein (PSK)
Representative CDS sequence Show only first row Show all	>Potri.007G006800.1 pacid=42765227 polypeptide=Potri.007G006800.1.p locus=Potri.007G006800 ID=Potri.007G006800.1.v4.1 annot-version=v4.1 ATGGCCAATGTTAAGGTTACAACACTCTTCTTGATCGTATCCCTCCTCCTCTGCTCCACTCTAACCTACGCCGCCCGCCCTGAGCCAGGCTTCCCTAATG GTTCTTTGGCGAAGAACCAACAAAAGGTTGTTGATGCTGAGCATGCAGAGGTGATGGAAGAGAGCTGTGAAGGAGTTGGTGAGGAAGAGTGCTTGATGAG AAGGACACTTGCTGCTCACACCGATTACATCTATACCCAGAAGCACAAACCATGA
AA sequence Show only first row Show all	>Potri.007G006800.1 pacid=42765227 polypeptide=Potri.007G006800.1.p locus=Potri.007G006800 ID=Potri.007G006800.1.v4.1 annot-version=v4.1 MANVKVTTLFLIVSLLLCSTLTYAARPEPGFPNGSLAKNQQKVVDAEHAEVMEESCEGVGEEECLMRRTLAAHTDYIYTQKHKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G49780		ATPSK3(FORMERSY...	phytosulfokine 4 precursor (.1...		Potri.007G006800 [exp]	0	1	Pt-PSK3.1
AT4G39700			Heavy metal transport/detoxifi...		Potri.010G005300 [exp]	4.00	0.9172
AT3G17860	ZIM	TIFY6B, JAI3, J...	JASMONATE-INSENSITIVE 3, jasmo...		Potri.012G044900 [exp]	6.16	0.9238
					Potri.010G144600 [exp]	6.24	0.8982
AT2G45680	TCP	TCP9	TCP family transcription facto...		Potri.002G152200 [exp]	6.92	0.9197
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Potri.016G014300 [exp]	7.74	0.9061
AT3G22120		CWLP	cell wall-plasma membrane link...		Potri.006G008500 [exp]	8.48	0.8926
AT5G50210		SUFE3, OLD5, QS	SULFUR E 3, ONSET OF LEAF DEAT...		Potri.015G085300 [exp]	9.79	0.9217
AT2G01410			NHL domain-containing protein ...		Potri.006G111600 [exp]	13.03	0.8931
AT5G05220			unknown protein		Potri.013G090200 [exp]	15.29	0.9039
AT2G22860		ATPSK2	phytosulfokine 2 precursor (.1...		Potri.014G006900 [exp]	18.52	0.8603	Pt-PSK3.2

Compare expression of checked genes

Potri.007G006800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.