Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18040 197 / 5e-67 PIN1AT "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) AT1G26550 63 / 2e-13 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G089900 [exp] 64 / 9e-14 AT1G26550 214 / 1e-72 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014266 [exp] 210 / 1e-71 AT2G18040 199 / 9e-68 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) Lus10025967 [exp] 210 / 7e-71 AT2G18040 200 / 8e-67 "peptidylprolyl cis/trans isomerase, NIMA-interacting 1", peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (.1) Lus10019084 [exp] 66 / 1e-14 AT1G26550 225 / 4e-77 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10015714 [exp] 66 / 2e-14 AT1G26550 224 / 1e-76 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00639 [poplar] [flax] Rotamase PPIC-type PPIASE domain
Representative CDS sequence Show only first row Show all	>Potri.007G013400.1 pacid=42766735 polypeptide=Potri.007G013400.1.p locus=Potri.007G013400 ID=Potri.007G013400.1.v4.1 annot-version=v4.1 ATGGCATCATCTGCATCAGGGACTCAAGTTCGAGCATCACACATCCTAATAAAACACGAGGGTTCAAGAAGGAAGGCATCATGGAAAGACCCAGAAGGTC GTGTGATCAAAAACACGACAAGGGATAGTGCTATTTCTGAACTCAAAGCAATTAGAGAGGATATTGTTTCTGGCAAAGCTAAGTTTGAGGATGTCGCTTC TAGAATCTCTGATTGTAGCTCTGCTAAACGTGGCGGCGATCTCGGGCCCTTTGGTCGAGGCCAGATGCAGAAGCCTTTTGAAGAGACTACCTTCTCTCTT AAGGTTGGTGAGATAAGTGACATAGTGGATACTGACAGTGGAGTTCACATCATCTTGAGGACTGGCTAA
AA sequence Show only first row Show all	>Potri.007G013400.1 pacid=42766735 polypeptide=Potri.007G013400.1.p locus=Potri.007G013400 ID=Potri.007G013400.1.v4.1 annot-version=v4.1 MASSASGTQVRASHILIKHEGSRRKASWKDPEGRVIKNTTRDSAISELKAIREDIVSGKAKFEDVASRISDCSSAKRGGDLGPFGRGQMQKPFEETTFSL KVGEISDIVDTDSGVHIILRTG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18040		PIN1AT	"peptidylprolyl cis/trans isom...		Potri.007G013400 [exp]	0	1
AT5G40580		PBB2	20S proteasome beta subunit PB...		Potri.017G071100 [exp]	13.60	0.8594	PBB1.1
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Potri.006G141300 [exp]	13.63	0.8429
AT2G44680		CKB4	casein kinase II beta subunit...		Potri.014G052100 [exp]	18.97	0.8543	Pt-CKB3.1
AT5G59410			Rab5-interacting family protei...		Potri.001G241500 [exp]	24.00	0.8736
AT1G15760			Sterile alpha motif (SAM) doma...		Potri.001G204600 [exp]	26.49	0.8450
AT3G07480			2Fe-2S ferredoxin-like superfa...		Potri.014G177100 [exp]	26.60	0.8668
AT2G34250			SecY protein transport family ...		Potri.011G107900 [exp]	29.39	0.8344
AT1G64520		RPN12A	regulatory particle non-ATPase...		Potri.001G088200 [exp]	30.59	0.8575
AT5G49510		PFD3, PDF3	prefoldin 3 (.1.2)		Potri.010G147600 [exp]	31.41	0.8468
AT4G12590			Protein of unknown function DU...		Potri.006G011500 [exp]	37.41	0.8370

Compare expression of checked genes

Potri.007G013400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.