Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	HFO909
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59970 162 / 1e-53 Histone superfamily protein (.1) AT5G59690 162 / 1e-53 Histone superfamily protein (.1) AT3G46320 162 / 1e-53 Histone superfamily protein (.1) AT3G53730 162 / 1e-53 Histone superfamily protein (.1) AT3G45930 162 / 1e-53 Histone superfamily protein (.1) AT2G28740 162 / 1e-53 HIS4 histone H4 (.1) AT1G07820 162 / 1e-53 Histone superfamily protein (.1.2) AT1G07660 162 / 1e-53 Histone superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G047500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G013300 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G012500 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.006G168100 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G214000 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G213900 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092900 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G093000 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092666 [exp] 162 / 1e-53 AT5G59970 162 / 1e-53 Histone superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005448 [exp] 162 / 1e-53 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10041919 [exp] 162 / 1e-53 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10019956 [exp] 162 / 1e-53 AT3G46320 199 / 2e-68 Histone superfamily protein (.1) Lus10040849 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10038481 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10014264 [exp] 162 / 1e-53 AT5G59690 199 / 2e-68 Histone superfamily protein (.1) Lus10028464 [exp] 162 / 1e-53 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10025964 [exp] 162 / 1e-53 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10015492 [exp] 162 / 1e-53 AT1G07820 199 / 2e-68 Histone superfamily protein (.1.2) Lus10004949 [exp] 162 / 1e-53 AT3G53730 199 / 2e-68 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [poplar] [flax] Histone PF15511 [poplar] [flax] CENP-T_C Centromere kinetochore component CENP-T histone fold
Representative CDS sequence Show only first row Show all	>Potri.007G013500.1 pacid=42766078 polypeptide=Potri.007G013500.1.p locus=Potri.007G013500 ID=Potri.007G013500.1.v4.1 annot-version=v4.1 ATGTCGGGAAGAGGAAAGGGCGGAAAGGGGCTGGGAAAGGGAGGTGCAAAGAGGCACAGGAAGGTGTTGAGAGATAACATCCAAGGAATCACAAAGCCAG CAATTAGAAGGCTAGCAAGAAGAGGAGGCGTGAAGAGAATTAGTGGGCTGATCTACGAGGAAACTAGAGGGGTTTTGAAGATCTTCCTTGAGAACGTGAT TCGTGATGCTGTTACTTATACAGAGCATGCTAGGAGAAAGACTGTCACTGCCATGGATGTTGTCTATGCTCTTAAGAGGCAAGGTCGTACTTTGTATGGG TTTGGGGGTTAG
AA sequence Show only first row Show all	>Potri.007G013500.1 pacid=42766078 polypeptide=Potri.007G013500.1.p locus=Potri.007G013500 ID=Potri.007G013500.1.v4.1 annot-version=v4.1 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYG FGG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G59970			Histone superfamily protein (....		Potri.007G013500 [exp]	0	1	HFO909
AT3G14740			RING/FYVE/PHD zinc finger supe...		Potri.011G103100 [exp]	1.00	0.9273
AT1G06475			unknown protein		Potri.002G058400 [exp]	2.00	0.9117
AT5G52220			unknown protein		Potri.015G140200 [exp]	2.64	0.8645
AT4G15790			unknown protein		Potri.010G024600 [exp]	3.00	0.9109
AT4G29910		EMB2798, ORC5, ...	EMBRYO DEFECTIVE 2798, origin ...		Potri.014G085900 [exp]	5.47	0.8755
AT1G47230		CYCA3;4	CYCLIN A3;4 (.1.2)		Potri.002G121500 [exp]	5.65	0.8869	CYCA3.1
AT1G09815		POLD4	polymerase delta 4 (.1)		Potri.013G076400 [exp]	6.48	0.8667
AT1G06475			unknown protein		Potri.005G203800 [exp]	6.70	0.8425
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Potri.009G132000 [exp]	6.92	0.8106
AT5G07900			Mitochondrial transcription te...		Potri.001G034900 [exp]	8.94	0.8583

Compare expression of checked genes

Potri.007G013500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.