Potri.007G014000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66290 169 / 7e-54 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G116300 202 / 7e-67 AT5G66290 229 / 8e-77 unknown protein
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G014000.4 pacid=42766250 polypeptide=Potri.007G014000.4.p locus=Potri.007G014000 ID=Potri.007G014000.4.v4.1 annot-version=v4.1
ATGGGTGCCTCAGAATCTAGTCTTTCAAGTTCACAGAAAATGACAGACGAAATCACTACTGTCACTGAGAGATCAGAAGCTTTGGATCCCATTTTGGAGA
AGCTCAAATCCCTCAAAATTACAAGGCCAATATTAACTTCAACTCCGAAGGAAGAGGGTAGCTTGAATGACATTTTGGTGAGGAAGGCATCGTCTTCTTC
AGCTCTTGCAACTGTAAATCCAAATGTGTTATTGGAGCTCATCTCAATATATCGTGATTGGCAAGACGGGAAGGTTCAGCAGATAAGCATGAAACAGGAG
GAGATAGAAAATAAGATAGAAGTGGCAGATGCTTTGGCAATTAAACTTCTTCAAAGGCTTAACTACTCTGTGTCAGCAATGAAGACTTCTTCACAGCATC
TATCAGAAGGTACTTCACAACATACCGAATGGAAATGGATTACTGACAGATTATGGAACCAGATACATAAATTATCAGAGAATTGA
AA sequence
>Potri.007G014000.4 pacid=42766250 polypeptide=Potri.007G014000.4.p locus=Potri.007G014000 ID=Potri.007G014000.4.v4.1 annot-version=v4.1
MGASESSLSSSQKMTDEITTVTERSEALDPILEKLKSLKITRPILTSTPKEEGSLNDILVRKASSSSALATVNPNVLLELISIYRDWQDGKVQQISMKQE
EIENKIEVADALAIKLLQRLNYSVSAMKTSSQHLSEGTSQHTEWKWITDRLWNQIHKLSEN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G66290 unknown protein Potri.007G014000 0 1
AT2G27490 ATCOAE dephospho-CoA kinase family (.... Potri.008G053601 7.14 0.8038
AT4G39280 phenylalanyl-tRNA synthetase, ... Potri.009G116100 8.06 0.7675
AT4G39630 unknown protein Potri.007G085100 8.30 0.7751
AT1G79070 SNARE-associated protein-relat... Potri.008G043200 12.80 0.8030
AT3G58470 nucleic acid binding;methyltra... Potri.016G063600 22.27 0.7465
AT3G13580 Ribosomal protein L30/L7 famil... Potri.008G008000 24.49 0.7298 RPL7.3
AT5G30495 Fcf2 pre-rRNA processing prote... Potri.010G002100 25.53 0.7685
AT3G57080 RPB5B, NRPE5 RNA POLYMERASE II FIFTH LARGES... Potri.016G038500 30.29 0.7459
AT5G41315 bHLH MYC6.2, GL3 GLABROUS 3, GLABRA 3, basic he... Potri.003G128000 32.32 0.7332 Pt-GL3.2
AT5G10620 methyltransferases (.1) Potri.006G278500 37.50 0.7501

Potri.007G014000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.