Potri.007G017200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17280 43 / 7e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041805 41 / 3e-05 AT5G17280 71 / 6e-17 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09791 Oxidored-like Oxidoreductase-like protein, N-terminal
Representative CDS sequence
>Potri.007G017200.1 pacid=42766314 polypeptide=Potri.007G017200.1.p locus=Potri.007G017200 ID=Potri.007G017200.1.v4.1 annot-version=v4.1
ATGGAAGCGACCCTCCATAATCATTTTCTTTCTCGAATCTTCTCTTACACGTTACCAAAACCCAAAAACCCACCAAATGACCCGACCCATTTTATCTTCG
CCATGAAAAACCCATTTAAGCCAATATTTATATCACCAAAAACAATCACCTTCAATTCAAGATCTCAAGATCCCAAATCCTGTCACGTTACTGCCAATTT
TGTAATGGCAACGGAAAATAAAAATCAACAGATTGAATCAACGGTGATGAGTAAACAAGGAGAGGAAGAATCGAAGAAGAAGACGGCTCCCCCGCCGCCG
CCGCCCCCCGAGAAGCCGGAGCCAGGAGATTGTTGTGGGAGTGGATGTGTTCGATGTGTCTGGGATGTGTATTATGAGGAGCTTGAGGAATATGACAAGC
TTTATAAATCTGATTCTTCAAAATCTTAG
AA sequence
>Potri.007G017200.1 pacid=42766314 polypeptide=Potri.007G017200.1.p locus=Potri.007G017200 ID=Potri.007G017200.1.v4.1 annot-version=v4.1
MEATLHNHFLSRIFSYTLPKPKNPPNDPTHFIFAMKNPFKPIFISPKTITFNSRSQDPKSCHVTANFVMATENKNQQIESTVMSKQGEEESKKKTAPPPP
PPPEKPEPGDCCGSGCVRCVWDVYYEELEEYDKLYKSDSSKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G17280 unknown protein Potri.007G017200 0 1
AT4G31550 WRKY ATWRKY11, WRKY1... WRKY DNA-binding protein 11 (.... Potri.018G139300 2.44 0.7148
AT5G06660 Protein of unknown function DU... Potri.016G060300 9.74 0.7300
AT5G16510 RGP5 reversibly glycosylated protei... Potri.019G051700 10.39 0.6118
AT3G54130 Josephin family protein (.1) Potri.016G110300 11.83 0.7083
AT1G32730 unknown protein Potri.003G085901 13.49 0.7526
AT4G17960 unknown protein Potri.001G143600 16.88 0.7435
AT3G61660 unknown protein Potri.003G137600 18.86 0.7336
AT5G46020 unknown protein Potri.011G060800 20.17 0.6926
AT5G60860 AtRABA1f RAB GTPase homolog A1F (.1) Potri.001G374000 22.80 0.6841 RAB11.4
AT1G17530 ATTIM23-1 translocase of inner mitochond... Potri.001G198100 26.70 0.6582 ATTIM23.2

Potri.007G017200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.