Potri.007G018300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51010 94 / 8e-25 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041795 96 / 2e-25 AT3G51010 175 / 5e-56 unknown protein
Lus10028346 91 / 2e-23 AT3G51010 172 / 7e-55 unknown protein
Lus10026320 91 / 2e-23 AT3G51010 176 / 2e-56 unknown protein
Lus10042347 84 / 4e-21 AT3G51010 170 / 5e-54 unknown protein
PFAM info
Representative CDS sequence
>Potri.007G018300.3 pacid=42764816 polypeptide=Potri.007G018300.3.p locus=Potri.007G018300 ID=Potri.007G018300.3.v4.1 annot-version=v4.1
ATGGGATTTGGAGCTCTAAGAAATGCAATTCGACCCTTGTCAAGAACCCTAACAACCCACGCCAGAACTTCCTCAACGACGCCGTTTTTGGCCTCAAAAC
CAGAGTTCAGGCTCTCTCTCAGTGGTGGAGGCCACTCTCCATGGACTCAAATGATCAGGCATTTCAGCTTCTTATCAGAAGCAAACCCTTTTGATAGATT
AACCAGCACTCGATTTCCTAAACGAAGACCCGTCGATAAGCCTCGGAGAAAAAGAGCCAGCTTGAAACCTCCAGGTCCATATGCCTGGGTTCAGTATGTA
CCAGGACAACCCATTAAACCCAATAATCCTAATGTAGGGAGTGTTAAGAGAAGGAATGAGAAGAAGCGCATCAGGCAACGCAAGGAGTTTATACTGGTTC
GTGTTCATTAA
AA sequence
>Potri.007G018300.3 pacid=42764816 polypeptide=Potri.007G018300.3.p locus=Potri.007G018300 ID=Potri.007G018300.3.v4.1 annot-version=v4.1
MGFGALRNAIRPLSRTLTTHARTSSTTPFLASKPEFRLSLSGGGHSPWTQMIRHFSFLSEANPFDRLTSTRFPKRRPVDKPRRKRASLKPPGPYAWVQYV
PGQPIKPNNPNVGSVKRRNEKKRIRQRKEFILVRVH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G51010 unknown protein Potri.007G018300 0 1
AT5G40770 ATPHB3 prohibitin 3 (.1) Potri.017G065800 7.93 0.8296 PHB3.1
AT4G11060 MTSSB mitochondrially targeted singl... Potri.013G011800 7.93 0.8009
AT3G02530 TCP-1/cpn60 chaperonin family ... Potri.004G101500 9.16 0.8127
AT2G28430 unknown protein Potri.004G210800 9.21 0.7937
AT5G47455 unknown protein Potri.001G333800 10.90 0.7819
AT5G27430 Signal peptidase subunit (.1) Potri.006G234600 12.64 0.7753 SPP.3
AT1G09640 Translation elongation factor ... Potri.013G103100 14.49 0.7634
AT5G56090 COX15 cytochrome c oxidase 15 (.1) Potri.011G166800 15.32 0.7359
AT4G24820 26S proteasome, regulatory sub... Potri.012G093500 15.71 0.7654
Potri.001G340100 17.23 0.7740

Potri.007G018300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.