Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36420 127 / 2e-37 Ribosomal protein L12 family protein (.1) AT1G70190 114 / 8e-32 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2) AT4G37660 99 / 3e-26 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) AT3G06040 99 / 3e-26 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) AT2G03130 66 / 5e-14 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) AT3G27850 63 / 2e-12 RPL12-C ribosomal protein L12-C (.1) AT3G27830 62 / 4e-12 RPL12-A ribosomal protein L12-A (.1) AT3G27840 54 / 5e-09 RPL12-B ribosomal protein L12-B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G077200 [exp] 108 / 6e-30 AT3G06040 132 / 3e-39 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) Potri.003G074800 [exp] 108 / 2e-29 AT1G70190 204 / 1e-66 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2) Potri.004G224300 [exp] 99 / 3e-26 AT4G37660 154 / 4e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Potri.001G346100 [exp] 67 / 1e-13 AT3G27830 146 / 1e-44 ribosomal protein L12-A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028336 [exp] 162 / 5e-51 AT4G36420 176 / 1e-56 Ribosomal protein L12 family protein (.1) Lus10041783 [exp] 160 / 4e-50 AT4G36420 174 / 5e-56 Ribosomal protein L12 family protein (.1) Lus10038367 [exp] 113 / 2e-31 AT1G70190 243 / 3e-82 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2) Lus10036228 [exp] 113 / 3e-31 AT1G70190 238 / 3e-80 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2) Lus10031180 [exp] 107 / 4e-29 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) Lus10031756 [exp] 107 / 5e-29 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3) Lus10000093 [exp] 102 / 2e-27 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Lus10023839 [exp] 102 / 2e-27 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Lus10021011 [exp] 101 / 6e-27 AT4G37660 157 / 3e-49 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1) Lus10013078 [exp] 72 / 1e-15 AT3G27830 175 / 7e-56 ribosomal protein L12-A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00542 [poplar] [flax] Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.007G019100.1 pacid=42765421 polypeptide=Potri.007G019100.1.p locus=Potri.007G019100 ID=Potri.007G019100.1.v4.1 annot-version=v4.1 ATGAGATCTTTACACTTCATTTCTCAAATCCACAAAACCCTAAAACTTAAAATAACCCCTCGTTTCACTCTCACATCCTCAAGTTTCACTCGCCGATTCA CATCTCCCTCTCAAGAATCAACTCCATCTCCTCAAGAACCACCGCCATCAACTGATAGGGTCTCCTCAATTGTGGATGAACTCTCAAAATTAACCCTTCT GGAGGTATCTGATTTAACTGAGGTTTTGCGTACTAAATTGGAGATCAAGGAAATGCCAGTGATGGCGGTGATGATGCCAGGAATGGGGTTCAGTATGGGA GCGGGGATGAAGGGCGGTGGTGGTGGTGGGGCAGCAGCGGCGAAGGCGGAAGAGAAGGTGGAGAAGACAGTGTTTGATGTGAAATTAGAAGGGTTTGATG CGGCAGTGAAGATTAAAGTTATTAAGGAAGTTAGAGGTTTTACTGATTTGGGATTGAAGGAAGCTAAAGATTTAGTGGAAAAGGCACCAACTTTGTTGAA AAAAGGAGTTACTAAAGATGAAGCTGAAAAGATTATTGAGAAAATGAAGGGAGTTGGGGCTAAAGTTACAATGGAATAA
AA sequence Show only first row Show all	>Potri.007G019100.1 pacid=42765421 polypeptide=Potri.007G019100.1.p locus=Potri.007G019100 ID=Potri.007G019100.1.v4.1 annot-version=v4.1 MRSLHFISQIHKTLKLKITPRFTLTSSSFTRRFTSPSQESTPSPQEPPPSTDRVSSIVDELSKLTLLEVSDLTEVLRTKLEIKEMPVMAVMMPGMGFSMG AGMKGGGGGGAAAAKAEEKVEKTVFDVKLEGFDAAVKIKVIKEVRGFTDLGLKEAKDLVEKAPTLLKKGVTKDEAEKIIEKMKGVGAKVTME

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G36420			Ribosomal protein L12 family p...		Potri.007G019100 [exp]	0	1
AT4G23620			Ribosomal protein L25/Gln-tRNA...		Potri.001G097801 [exp]	2.23	0.8374
AT2G37230			Tetratricopeptide repeat (TPR)...		Potri.010G077400 [exp]	11.40	0.7344
AT1G61870		PPR336	pentatricopeptide repeat 336 (...		Potri.004G018000 [exp]	12.44	0.7674
AT2G44860			Ribosomal protein L24e family ...		Potri.009G148500 [exp]	13.85	0.7738
AT1G63780		IMP4	Ribosomal RNA processing Brix ...		Potri.001G024500 [exp]	15.65	0.7590	Pt-IMP4.1
AT2G44120			Ribosomal protein L30/L7 famil...		Potri.006G073200 [exp]	17.66	0.7881
AT3G01800			Ribosome recycling factor (.1)		Potri.001G333700 [exp]	19.44	0.7615
AT1G79650		AtAO1, RAD23B, ...	RADIATION SENSITIVE23B, Arabid...		Potri.001G038000 [exp]	22.20	0.7203	RAD23.1
AT5G14600			S-adenosyl-L-methionine-depend...		Potri.018G120500 [exp]	22.44	0.7079
AT1G09760		U2A'	U2 small nuclear ribonucleopro...		Potri.003G158800 [exp]	23.64	0.7251

Compare expression of checked genes

Potri.007G019100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.