Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50940 74 / 1e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G50930 71 / 3e-15 BCS1 cytochrome BC1 synthesis (.1) AT1G43910 64 / 1e-12 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT4G05380 57 / 8e-11 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17760 58 / 1e-10 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT2G18193 57 / 3e-10 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28600 56 / 6e-10 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G18190 55 / 9e-10 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G28610 54 / 2e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G17730 54 / 3e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G019600 [exp] 96 / 5e-24 AT1G43910 536 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.005G119200 [exp] 89 / 1e-21 AT1G43910 530 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.009G119132 [exp] 79 / 5e-18 AT3G50930 484 / 3e-166 cytochrome BC1 synthesis (.1) Potri.009G119066 [exp] 77 / 1e-17 AT3G50930 471 / 4e-161 cytochrome BC1 synthesis (.1) Potri.007G020900 [exp] 73 / 4e-16 AT3G50930 561 / 0.0 cytochrome BC1 synthesis (.1) Potri.008G177200 [exp] 67 / 6e-14 AT3G50940 401 / 4e-136 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.002G032700 [exp] 66 / 1e-13 AT3G50930 437 / 1e-149 cytochrome BC1 synthesis (.1) Potri.005G119900 [exp] 66 / 2e-13 AT5G17760 512 / 3e-179 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.010G057900 [exp] 65 / 3e-13 AT3G50930 396 / 1e-133 cytochrome BC1 synthesis (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037004 [exp] 67 / 6e-14 AT3G50930 457 / 9e-159 cytochrome BC1 synthesis (.1) Lus10041918 [exp] 66 / 1e-13 AT3G50930 383 / 2e-126 cytochrome BC1 synthesis (.1) Lus10015802 [exp] 66 / 2e-13 AT3G50940 462 / 9e-161 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10025989 [exp] 64 / 7e-13 AT3G50930 445 / 1e-153 cytochrome BC1 synthesis (.1) Lus10028463 [exp] 63 / 2e-12 AT3G50930 340 / 2e-111 cytochrome BC1 synthesis (.1) Lus10014284 [exp] 61 / 9e-12 AT3G50930 535 / 0.0 cytochrome BC1 synthesis (.1) Lus10042166 [exp] 57 / 3e-10 AT5G40010 526 / 0.0 ATPase-in-Seed-Development, AAA-ATPase 1 (.1) Lus10004258 [exp] 54 / 2e-09 AT3G28580 507 / 1e-176 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10031318 [exp] 54 / 3e-09 AT2G18193 415 / 1e-140 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10024275 [exp] 52 / 1e-08 AT3G50940 434 / 2e-149 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.007G019700.2 pacid=42765118 polypeptide=Potri.007G019700.2.p locus=Potri.007G019700 ID=Potri.007G019700.2.v4.1 annot-version=v4.1 ATGTTGTCAAGCTTTGGGGAAGAAAGAATCAACATCTTCACAAACAACTACAGAGAGAGACTAGACCCAGCATTGCTTGCATTGACATATCTAGGAATTG AAGACCATGGATTTTTCAAGTGCATTGAAGATCTAATTCAGAGGATATCAGTTACCCCAGCAGAAGTATCACAGCAACTTAAGAAATGTAACAAAACGCA AGGTGCTATTGAAAGTCTCATCGAGTTTCTGAATATGGAGGAAGAATCAGCAGAGGAGGATAATGACACGGAAGATGAAATGATTTTCTTCTTGAATCAA GCAGGACCATTTCCTGCCTGCCATTTTAAATACAGATTGCATTCTAATTTTCCAGTTGAATTCGCTTGA
AA sequence Show only first row Show all	>Potri.007G019700.2 pacid=42765118 polypeptide=Potri.007G019700.2.p locus=Potri.007G019700 ID=Potri.007G019700.2.v4.1 annot-version=v4.1 MLSSFGEERINIFTNNYRERLDPALLALTYLGIEDHGFFKCIEDLIQRISVTPAEVSQQLKKCNKTQGAIESLIEFLNMEEESAEEDNDTEDEMIFFLNQ AGPFPACHFKYRLHSNFPVEFA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G50940			P-loop containing nucleoside t...		Potri.007G019700 [exp]	0	1
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Potri.014G046600 [exp]	5.83	0.9400
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Potri.014G047000 [exp]	8.00	0.9395	ERF7
AT1G58290		AtHEMA1, HEMA1	Arabidopsis thaliana hemA 1, G...		Potri.009G080600 [exp]	10.95	0.9312
AT3G47570			Leucine-rich repeat protein ki...		Potri.011G102800 [exp]	17.20	0.9189
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Potri.008G132850 [exp]	17.54	0.8880
AT5G37490			ARM repeat superfamily protein...		Potri.015G031000 [exp]	20.39	0.9264
AT4G08250	GRAS		GRAS family transcription fact...		Potri.005G190300 [exp]	22.69	0.9238	GRAS43
					Potri.003G102000 [exp]	24.81	0.8764
AT5G41330			BTB/POZ domain with WD40/YVTN ...		Potri.001G102300 [exp]	24.97	0.9105
AT5G09360		LAC14	laccase 14 (.1)		Potri.019G088700 [exp]	26.83	0.9065

Compare expression of checked genes

Potri.007G019700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.