Potri.007G020000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75388 70 / 1e-18 CPuORF5 conserved peptide upstream open reading frame 5 (.1)
AT2G18162 67 / 2e-17 CPuORF1 conserved peptide upstream open reading frame 1 (.1)
AT4G34588 60 / 1e-14 CPuORF2 conserved peptide upstream open reading frame 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G032000 71 / 5e-19 AT1G75388 76 / 5e-21 conserved peptide upstream open reading frame 5 (.1)
Potri.005G119400 71 / 5e-19 AT1G75388 61 / 3e-15 conserved peptide upstream open reading frame 5 (.1)
Potri.005G231250 68 / 7e-18 AT1G75388 74 / 7e-20 conserved peptide upstream open reading frame 5 (.1)
Potri.009G119650 61 / 8e-15 AT4G34588 72 / 2e-19 conserved peptide upstream open reading frame 2 (.1)
Potri.004G158150 59 / 2e-14 AT4G34588 71 / 5e-19 conserved peptide upstream open reading frame 2 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G020000.1 pacid=42765569 polypeptide=Potri.007G020000.1.p locus=Potri.007G020000 ID=Potri.007G020000.1.v4.1 annot-version=v4.1
ATGACTCCTGTACTCTGTGAAATCCTCCTTTCTGGTTTCACGATAAACTCAACTCTTAGGCGCGGGACTCACCTTGTTCAATCCTTCTCTGTTGTCTTCC
TCTACTGGTTCTATGTTTTCTCATGA
AA sequence
>Potri.007G020000.1 pacid=42765569 polypeptide=Potri.007G020000.1.p locus=Potri.007G020000 ID=Potri.007G020000.1.v4.1 annot-version=v4.1
MTPVLCEILLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G75388 CPuORF5 conserved peptide upstream ope... Potri.007G020000 0 1
AT3G28540 P-loop containing nucleoside t... Potri.004G091250 6.48 0.8383
AT4G35160 O-methyltransferase family pro... Potri.013G122000 10.86 0.8150
AT4G34150 Calcium-dependent lipid-bindin... Potri.001G301900 11.66 0.8114
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.011G006050 20.49 0.8140
AT2G20370 AtMUR3, MUR3, K... MURUS 3, KATAMARI 1, Exostosin... Potri.002G256200 26.45 0.7604
Potri.018G096014 28.93 0.7992
AT5G67210 IRX15-L IRX15-LIKE, Protein of unknown... Potri.009G098800 30.38 0.7909
AT4G27950 AP2_ERF CRF4 cytokinin response factor 4 (.... Potri.019G131300 31.98 0.7588
Potri.004G179877 36.66 0.8012
Potri.015G120500 39.50 0.8006

Potri.007G020000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.