Plant FIBer expression Database

Potri.007G020400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66410 297 / 8e-103 PLP3B phosducin-like protein 3 homolog (.1)
AT3G50960 286 / 1e-98 PLP3A phosducin-like protein 3 homolog (.1)
AT3G25580 121 / 3e-34 Thioredoxin superfamily protein (.1)
AT2G18990 120 / 7e-34 TXND9 thioredoxin domain-containing protein 9 homolog (.1)
AT1G69880 40 / 0.0003 ATH8 thioredoxin H-type 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G297900
[exp]
109 / 2e-29 AT3G25580 286 / 3e-99 Thioredoxin superfamily protein (.1)
Potri.009G092700
[exp]
108 / 4e-29 AT2G18990 290 / 2e-100 thioredoxin domain-containing protein 9 homolog (.1)
Potri.017G076700
[exp]
47 / 1e-06 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Potri.019G054800
[exp]
41 / 0.0002 AT3G02730 204 / 1e-67 thioredoxin F-type 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025176
[exp]
291 / 3e-100 AT5G66410 362 / 1e-128 phosducin-like protein 3 homolog (.1)
Lus10016055
[exp]
287 / 5e-99 AT5G66410 357 / 2e-126 phosducin-like protein 3 homolog (.1)
Lus10013889
[exp]
111 / 1e-30 AT3G25580 255 / 1e-87 Thioredoxin superfamily protein (.1)
Lus10026602
[exp]
76 / 3e-17 AT3G25580 168 / 3e-54 Thioredoxin superfamily protein (.1)
Lus10005258
[exp]
42 / 6e-05 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
Lus10030666
[exp]
41 / 0.0001 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Potri.007G020400.1 pacid=42765792 polypeptide=Potri.007G020400.1.p locus=Potri.007G020400 ID=Potri.007G020400.1.v4.1 annot-version=v4.1
ATGGATCCTGATGCAGTTAAATCAACATTGTCAAATTTGGCATTTGGCAATGTAATAGCAGCAGCTGCTCGTGATTATAAGAAGGAAATTCTTGCTCAAG
AGAAGTTAAAGTCGTCGAGTTCTTTCAATGAAGAAGTTGACCTTGATGAGTTGATGGATGATCCAGAGCTGGAAAAATTGCATGCAGACAGGATTGCAGC
TCTCAAGAAAGAAGCCGAGAAACGAGAAGCCCTACAGAGGAAAGGCCATGGGGAATACAGGGAGATAAGCGAGGGGGATTTCCTGGGTGAAGTCACTGGG
ACTGAGAAAGTAATTTGCCATTTCTACCATAAGGAGTTCTATCGATGCAAGATAATGGATAAGCATTTGAAGTCTCTTGCACCAAGGCATGTTGATACCA
AATTCATCAAGCTGGATGCAGAGAATGCACCCTTCTTTGTTGCCAAACTTGGAGTGAAAACATTGCCTTGTGTCATGCTTTTCAGTAAAGGGATTGCAAT
AGATAGACTGGTTGGCTTTCAAGATATAGGAGGAAAAGATGATTTTGCCACTAGGACTCTTGAGATTATACTGATAAAAAAAGGTATAATTAGTGAGAAG
AAAGATAACGAAGATGATGAAGATGATGATTACCATGAAAACAGTCAAAGGACAGTAAGATCGTCTACCAATCCTGATTCCGATTCAGATTAA
AA sequence
>Potri.007G020400.1 pacid=42765792 polypeptide=Potri.007G020400.1.p locus=Potri.007G020400 ID=Potri.007G020400.1.v4.1 annot-version=v4.1
MDPDAVKSTLSNLAFGNVIAAAARDYKKEILAQEKLKSSSSFNEEVDLDELMDDPELEKLHADRIAALKKEAEKREALQRKGHGEYREISEGDFLGEVTG
TEKVICHFYHKEFYRCKIMDKHLKSLAPRHVDTKFIKLDAENAPFFVAKLGVKTLPCVMLFSKGIAIDRLVGFQDIGGKDDFATRTLEIILIKKGIISEK
KDNEDDEDDDYHENSQRTVRSSTNPDSDSD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G66410 PLP3B phosducin-like protein 3 homol... Potri.007G020400
[exp]
0 1
AT5G20500 Glutaredoxin family protein (.... Potri.018G133400
[exp]
1.41 0.9344
AT2G46210 AtSLD2 sphingoid LCB desaturase 2, Fa... Potri.002G165800
[exp]
1.41 0.9232
AT1G78900 VHA-A vacuolar ATP synthase subunit ... Potri.008G005000
[exp]
5.74 0.8899
AT1G78300 14-3-3OMEGA, GF... 14-3-3 PROTEIN G-BOX FACTOR14 ... Potri.002G099800
[exp]
6.24 0.9216 Pt-CHI.3
AT4G02620 vacuolar ATPase subunit F fami... Potri.005G217600
[exp]
8.48 0.9068 VATF.1
AT2G27020 PAG1 20S proteasome alpha subunit G... Potri.009G020800
[exp]
10.00 0.9172 PAG1.2
AT3G04780 Protein of unknown function (D... Potri.013G039500
[exp]
16.24 0.9001
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Potri.016G088200
[exp]
17.02 0.9078 SYP71.2
AT5G66140 PAD2 proteasome alpha subunit D2 (.... Potri.009G133800
[exp]
17.08 0.8468 Pt-PAD1.3
AT1G07960 ATPDIL5-1 PDI-like 5-1 (.1.2.3) Potri.009G004500
[exp]
19.74 0.8626

Potri.007G020400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.