Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05220 66 / 2e-13 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G19090 62 / 5e-12 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT3G06130 62 / 6e-12 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G26690 58 / 7e-12 Heavy metal transport/detoxification superfamily protein (.1) AT3G05920 57 / 2e-11 Heavy metal transport/detoxification superfamily protein (.1) AT5G52740 56 / 5e-11 Copper transport protein family (.1) AT5G37860 57 / 2e-10 Heavy metal transport/detoxification superfamily protein (.1) AT1G01490 56 / 2e-10 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G56891 55 / 3e-10 Heavy metal transport/detoxification superfamily protein (.1) AT4G23882 54 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G120200 [exp] 158 / 5e-51 AT3G05220 64 / 8e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.018G148900 [exp] 83 / 1e-21 AT1G01490 66 / 1e-14 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.002G032800 [exp] 74 / 5e-18 AT3G05920 52 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G230300 [exp] 72 / 3e-17 AT1G01490 57 / 3e-11 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.006G079400 [exp] 69 / 5e-16 AT5G37860 66 / 4e-14 Heavy metal transport/detoxification superfamily protein (.1) Potri.003G132200 [exp] 62 / 6e-13 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.001G099500 [exp] 61 / 8e-13 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G145516 [exp] 60 / 2e-12 AT1G01490 56 / 7e-11 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073000 [exp] 60 / 3e-12 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028331 [exp] 89 / 5e-23 AT1G06330 56 / 7e-10 Heavy metal transport/detoxification superfamily protein (.1) Lus10014967 [exp] 66 / 5e-14 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 65 / 4e-13 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 63 / 6e-13 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 61 / 8e-12 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10036395 [exp] 57 / 8e-11 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10041228 [exp] 58 / 1e-10 AT3G06130 149 / 3e-41 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10031514 [exp] 57 / 3e-10 AT5G19090 118 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1.2.3) Lus10039285 [exp] 54 / 8e-10 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027523 [exp] 54 / 9e-10 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.007G021200.1 pacid=42766618 polypeptide=Potri.007G021200.1.p locus=Potri.007G021200 ID=Potri.007G021200.1.v4.1 annot-version=v4.1 ATGGTACAGAGAACAGTCTTGAAGGTTGATATTTCATGCCAGAAATGCAAGACAAAGGTGCTCAAAGCTGTGTCTACACTTGAAGGTGTAGATACGATCG AGGCTGACCAAGGAAAGGGAACATTAACAGTAACAGGAAATGCAGACCCATATGAGATAATACTGCGTACAAGAAAAACAGGGAAGCATGCAGAGGTAGT GAGCATTGGGCCACCTCCGGCGCCACCAAAACAGGATGGGCAAAAGAAGGCAGAAGAGAAAAAGCCTCAAGAGAAGAAGACTGAACAGAAGGCCCTGATC TATGATCCATGCGCATGCCCTCAGTGTCAGCCAGTGCTTCTCATGCCAATGCCGGTGGGTCGGTGTGATGAGCCCAACCCATCATGCTCCATCATGTGA
AA sequence Show only first row Show all	>Potri.007G021200.1 pacid=42766618 polypeptide=Potri.007G021200.1.p locus=Potri.007G021200 ID=Potri.007G021200.1.v4.1 annot-version=v4.1 MVQRTVLKVDISCQKCKTKVLKAVSTLEGVDTIEADQGKGTLTVTGNADPYEIILRTRKTGKHAEVVSIGPPPAPPKQDGQKKAEEKKPQEKKTEQKALI YDPCACPQCQPVLLMPMPVGRCDEPNPSCSIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05220			Heavy metal transport/detoxifi...		Potri.007G021200 [exp]	0	1
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G025800 [exp]	2.64	0.9701
AT5G12380		ANNAT8	annexin 8 (.1)		Potri.003G200700 [exp]	3.46	0.9578	ANN1.1
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G026000 [exp]	4.00	0.9660
AT5G64700			nodulin MtN21 /EamA-like trans...		Potri.019G004100 [exp]	4.24	0.9632
					Potri.006G213801 [exp]	5.29	0.9266
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G025900 [exp]	6.00	0.9629
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G026700 [exp]	6.32	0.9588
AT5G26620			unknown protein		Potri.005G002600 [exp]	8.00	0.9261
AT3G05950			RmlC-like cupins superfamily p...		Potri.019G026500 [exp]	8.77	0.9562
AT5G26620			unknown protein		Potri.005G002500 [exp]	9.59	0.9237

Compare expression of checked genes

Potri.007G021200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.