Potri.007G021900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66470 535 / 0 RNA binding;GTP binding (.1)
AT1G30960 97 / 1e-21 GTP-binding family protein (.1)
AT3G12080 71 / 7e-13 EMB2738 embryo defective 2738, GTP-binding family protein (.1.2)
AT1G78010 64 / 1e-10 tRNA modification GTPase, putative (.1)
AT4G39520 50 / 2e-06 GTP-binding protein-related (.1)
AT2G27200 46 / 3e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G08410 46 / 5e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G22870 44 / 0.0001 EMB2001 embryo defective 2001, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G17470 43 / 0.0003 ATDRG1 developmentally regulated G-protein 1 (.1.2)
AT1G72660 43 / 0.0003 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G160800 91 / 9e-20 AT1G30960 491 / 4e-173 GTP-binding family protein (.1)
Potri.002G092600 56 / 2e-08 AT1G78010 688 / 0.0 tRNA modification GTPase, putative (.1)
Potri.009G054200 52 / 6e-07 AT3G12080 813 / 0.0 embryo defective 2738, GTP-binding family protein (.1.2)
Potri.007G080900 49 / 3e-06 AT4G39520 647 / 0.0 GTP-binding protein-related (.1)
Potri.009G017000 46 / 5e-05 AT1G08410 755 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.001G170300 42 / 0.0004 AT1G72660 677 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.003G063500 42 / 0.0005 AT1G72660 678 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014289 528 / 0 AT5G66470 587 / 0.0 RNA binding;GTP binding (.1)
Lus10025995 270 / 2e-83 AT5G66460 577 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10023046 86 / 7e-18 AT1G30960 499 / 5e-176 GTP-binding family protein (.1)
Lus10032427 86 / 8e-18 AT1G30960 489 / 1e-171 GTP-binding family protein (.1)
Lus10027371 66 / 2e-11 AT3G12080 874 / 0.0 embryo defective 2738, GTP-binding family protein (.1.2)
Lus10002557 66 / 4e-11 AT3G12080 869 / 0.0 embryo defective 2738, GTP-binding family protein (.1.2)
Lus10029578 56 / 3e-08 AT1G78010 677 / 0.0 tRNA modification GTPase, putative (.1)
Lus10006309 56 / 5e-08 AT1G78010 669 / 0.0 tRNA modification GTPase, putative (.1)
Lus10004103 49 / 5e-06 AT1G08410 756 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10013359 49 / 6e-06 AT1G08410 745 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF01926 MMR_HSR1 50S ribosome-binding GTPase
CL0007 KH PF07650 KH_2 KH domain
Representative CDS sequence
>Potri.007G021900.1 pacid=42766107 polypeptide=Potri.007G021900.1.p locus=Potri.007G021900 ID=Potri.007G021900.1.v4.1 annot-version=v4.1
ATGGAGCTAGTAGCTTTAAACCTCTCTACAAAAATTCCAAGACAGAAACCAACCTTCCTCTCTACAACAACAAAGACTCTTCTCTTTCGCAATTATCATT
ACCAGTTACGAAGAAGAGCAAGTAATCATTTTCGATTTCAAGCCAGGAATAAACAGCAGCAACAACTCTTGATTAGTCAAATAGATTCGGAAAGTGAGCT
GGAATTCGACAGCGATGAAGATGAAGACGAGATGTCGTCTGGTTTGTTATCATTAAGCGTGAAACCAGACAGGAACACGGCTTTGCTTGATGATTACGAG
ATTGAAGAACTTGCCTTTCATGATTCCTCCAATTCTAATCATCGTAGCGGGTACGTGGCAGTGGTAGGGAAACCGAATGTAGGAAAGAGCACGCTTTCGA
ATCAAATGATAGGACAAAAGTTGTCGATTGTTACTGATAAACCTCAGACTACTAGACATCGCATTCTTGGTATTTGTTCCGCTCCAGATTACCAGATGAT
ACTTTATGATACACCAGGTGTTATCGAGAAGAAAATGCACAAGTTGGATTCTATGATGATGAAGAATGTTAGGAGTGCTGCCATCAATGCTGACTGCGTG
CTAGTTATTGTTGATGCTTGCAGAGCACCTGAAAAGATTGATGAAATGCTGGAAGAAGGTGTGGGAAACCTCAAAGACAATGTGCCCACTTTACTTGTAT
TGAACAAGAAAGACTTGATCAAACCTGGTGAAATTGCAAAGAAACTTGAGTGGTATGAGAAATTTACAGGTGTTGATGAGGTCATACCTGTGAGTGCCAA
ATTTGGTCAAGGAGTGGAAGATATCAAGGAATGGATACTTTCAAAACTTCCCATGGGGCCAGCTTATTATCCAAAGGACATTGTTAGTGAGCACCCAGAA
AGATTCTTTGTAGCTGAAATTGTTAGAGAAAAGATCTTTATGCAATTCCGCAATGAGGTTCCTTATGCATGTCAGGTCAATGTGGTCGGCTATAAAGCTA
GGCCAACAGCCAAAGATTTTATTCAAGTGGAGATTGTTGTGGAGAAGAACACACAGAAGATCATTATCATTGGAAAAGAAGGGAAGGCTTTGAAATTACT
TGCCACAGCTGCTCGGCTGGACATTGAGGATTTCCTTCAGAAGAAAGTATATCTTGAGATAGAAGTGAAAGTAAAAGAGAATTGGCGGCAAGATGAAGGG
CTTTTGAAGTACTATGGCTATGGAGGGCAAATTAGCGCATTATAG
AA sequence
>Potri.007G021900.1 pacid=42766107 polypeptide=Potri.007G021900.1.p locus=Potri.007G021900 ID=Potri.007G021900.1.v4.1 annot-version=v4.1
MELVALNLSTKIPRQKPTFLSTTTKTLLFRNYHYQLRRRASNHFRFQARNKQQQQLLISQIDSESELEFDSDEDEDEMSSGLLSLSVKPDRNTALLDDYE
IEELAFHDSSNSNHRSGYVAVVGKPNVGKSTLSNQMIGQKLSIVTDKPQTTRHRILGICSAPDYQMILYDTPGVIEKKMHKLDSMMMKNVRSAAINADCV
LVIVDACRAPEKIDEMLEEGVGNLKDNVPTLLVLNKKDLIKPGEIAKKLEWYEKFTGVDEVIPVSAKFGQGVEDIKEWILSKLPMGPAYYPKDIVSEHPE
RFFVAEIVREKIFMQFRNEVPYACQVNVVGYKARPTAKDFIQVEIVVEKNTQKIIIIGKEGKALKLLATAARLDIEDFLQKKVYLEIEVKVKENWRQDEG
LLKYYGYGGQISAL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G66470 RNA binding;GTP binding (.1) Potri.007G021900 0 1
AT1G52730 Transducin/WD40 repeat-like su... Potri.001G174600 1.00 0.9563
AT5G64380 Inositol monophosphatase famil... Potri.017G042900 9.53 0.9399
AT5G53080 Tetratricopeptide repeat (TPR)... Potri.015G010800 9.79 0.9499
AT4G38490 unknown protein Potri.004G177800 10.81 0.9293
AT3G24590 PLSP1 plastidic type i signal peptid... Potri.018G081800 10.95 0.9485
AT1G78630 EMB1473 embryo defective 1473, Ribosom... Potri.011G106100 12.96 0.9459
AT1G11290 CRR22 CHLORORESPIRATORY REDUCTION22,... Potri.003G191000 14.38 0.9493
AT3G04310 unknown protein Potri.010G063300 16.43 0.9443
AT3G53700 MEE40 maternal effect embryo arrest ... Potri.004G013300 18.57 0.9374
AT1G33780 Protein of unknown function (D... Potri.019G073000 19.39 0.9272

Potri.007G021900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.