Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18400 173 / 7e-58 ribosomal protein L6 family protein (.1) AT1G05190 86 / 4e-22 EMB2394 embryo defective 2394, Ribosomal protein L6 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G153000 [exp] 84 / 3e-21 AT1G05190 338 / 3e-119 embryo defective 2394, Ribosomal protein L6 family (.1) Potri.002G229350 [exp] 71 / 3e-17 AT1G05190 138 / 3e-42 embryo defective 2394, Ribosomal protein L6 family (.1) Potri.002G229325 [exp] 73 / 4e-17 AT1G05190 272 / 2e-93 embryo defective 2394, Ribosomal protein L6 family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026015 [exp] 190 / 1e-63 AT2G18400 181 / 1e-59 ribosomal protein L6 family protein (.1) Lus10014306 [exp] 186 / 8e-63 AT2G18400 179 / 4e-60 ribosomal protein L6 family protein (.1) Lus10029120 [exp] 78 / 1e-18 AT1G05190 312 / 5e-109 embryo defective 2394, Ribosomal protein L6 family (.1) Lus10013041 [exp] 78 / 2e-18 AT1G05190 310 / 3e-107 embryo defective 2394, Ribosomal protein L6 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00347 [poplar] [flax] Ribosomal_L6 Ribosomal protein L6
Representative CDS sequence Show only first row Show all	>Potri.007G024900.3 pacid=42766819 polypeptide=Potri.007G024900.3.p locus=Potri.007G024900 ID=Potri.007G024900.3.v4.1 annot-version=v4.1 ATGGAAGCCAAGTTCTTTCGATTTCTCAAAATTGTAGGTGTTGGTTACAAAGCGCGAGCAGAAGCAGAAGGCCGTTTGTTATTTCTCAAACTGGGTTACA GTCATGAAGTCGAACTAACTGTGCCGCCTGCAGTCCGGGTGTTTTGTTTCAAGAACAATGTGGTTTGCTGTACTGGAATTGATAAGGGAAGAGTGCATCA GTTTGCTGCTTCAGTTCGTAGTTGTAAGCCACCTGAAGTTTATAAAGGCAAAGGGATCATGTATATTGATGAAGTTATTAAGAAGAAACAAGGAAAGAAG TCAAAATGA
AA sequence Show only first row Show all	>Potri.007G024900.3 pacid=42766819 polypeptide=Potri.007G024900.3.p locus=Potri.007G024900 ID=Potri.007G024900.3.v4.1 annot-version=v4.1 MEAKFFRFLKIVGVGYKARAEAEGRLLFLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGIDKGRVHQFAASVRSCKPPEVYKGKGIMYIDEVIKKKQGKK SK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18400			ribosomal protein L6 family pr...		Potri.007G024900 [exp]	0	1
AT3G59650			mitochondrial ribosomal protei...		Potri.013G126200 [exp]	1.00	0.9027
AT3G13230			RNA-binding KH domain-containi...		Potri.011G166000 [exp]	1.41	0.8745
AT2G20060			Ribosomal protein L4/L1 family...		Potri.004G004800 [exp]	2.00	0.8441
AT4G30330			Small nuclear ribonucleoprotei...		Potri.006G174000 [exp]	2.64	0.8239
AT3G08980			Peptidase S24/S26A/S26B/S26C f...		Potri.016G115100 [exp]	4.24	0.8587
AT3G05810			unknown protein		Potri.013G007600 [exp]	6.70	0.8138
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Potri.001G069100 [exp]	6.92	0.8248	Pt-ARS27.2
AT5G50810		TIM8	translocase inner membrane sub...		Potri.012G103400 [exp]	7.07	0.8071
AT1G06010			unknown protein		Potri.012G134200 [exp]	8.71	0.7749
AT3G13674			unknown protein		Potri.018G082800 [exp]	9.74	0.8260

Compare expression of checked genes

Potri.007G024900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.