Potri.007G025400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1)
AT2G17380 118 / 2e-34 AP19 associated protein 19 (.1)
AT4G35410 115 / 2e-33 Clathrin adaptor complex small chain family protein (.1.2)
AT2G19790 107 / 3e-30 SNARE-like superfamily protein (.1)
AT1G47830 104 / 3e-29 SNARE-like superfamily protein (.1)
AT1G60970 48 / 3e-07 SNARE-like superfamily protein (.1)
AT4G08520 45 / 3e-06 SNARE-like superfamily protein (.1)
AT3G09800 44 / 9e-06 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G122900 304 / 1e-107 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1)
Potri.012G052000 119 / 9e-35 AT2G17380 307 / 6e-109 associated protein 19 (.1)
Potri.014G079000 116 / 1e-33 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2)
Potri.006G149100 107 / 4e-30 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1)
Potri.005G238701 107 / 5e-30 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1)
Potri.002G022900 105 / 1e-29 AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1)
Potri.002G001800 106 / 3e-29 AT2G17380 278 / 3e-97 associated protein 19 (.1)
Potri.001G352900 44 / 6e-06 AT1G60970 278 / 6e-97 SNARE-like superfamily protein (.1)
Potri.003G043200 39 / 0.0004 AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041742 285 / 6e-100 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1)
Lus10024011 222 / 4e-75 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1)
Lus10042352 118 / 7e-34 AT2G17380 297 / 3e-104 associated protein 19 (.1)
Lus10026316 116 / 2e-33 AT2G17380 297 / 7e-105 associated protein 19 (.1)
Lus10012924 104 / 6e-29 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1)
Lus10024337 103 / 7e-28 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1)
Lus10035004 100 / 2e-27 AT2G19790 262 / 6e-92 SNARE-like superfamily protein (.1)
Lus10003641 96 / 1e-25 AT4G35410 251 / 8e-87 Clathrin adaptor complex small chain family protein (.1.2)
Lus10037624 42 / 5e-05 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Lus10006883 42 / 5e-05 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Potri.007G025400.1 pacid=42765850 polypeptide=Potri.007G025400.1.p locus=Potri.007G025400 ID=Potri.007G025400.1.v4.1 annot-version=v4.1
ATGATAAAAGCGGTGCTGGTGATTAACACCCAAGGCAAACCTCGCCTTACCAAATTCTACGATTTTTTGACTGTAGAGAAGCAGCAAGAGCTTATACGCG
GTGTATTTGGAGTGTTATGTACTAGAGCTGAGAAAGTTAGCAATTTCATGGAGGTTGATTCAATCTTCGGCCCGGATAGTCGTCTTGTGTACAAACATTA
TGCAACATTGTACTTTGTCTTTGTGTTTGATAGTTCTGAGAACGAGCTTGCGATGCTTGATCTCATACAAGTTTTTGTAGAAACATTGGACAAGTGCTTC
AGGAATGTATGCGAGCTTGACATTGTGTTCAATTACAGCAAGCTCCATGCTATTATAGATGAGATAATTTCTGGAGGTCAAGTGTTGGAAACAAGTTCTA
CAGAAGTTATGAGAGCTGTTGAAGAAATATCAAAGTCAGAAGCAGCCTCAAATTCCATCTCATTAGTCCCCAAAACAGTTTCTGGTTGGCGGAGCCGGTA
A
AA sequence
>Potri.007G025400.1 pacid=42765850 polypeptide=Potri.007G025400.1.p locus=Potri.007G025400 ID=Potri.007G025400.1.v4.1 annot-version=v4.1
MIKAVLVINTQGKPRLTKFYDFLTVEKQQELIRGVFGVLCTRAEKVSNFMEVDSIFGPDSRLVYKHYATLYFVFVFDSSENELAMLDLIQVFVETLDKCF
RNVCELDIVFNYSKLHAIIDEIISGGQVLETSSTEVMRAVEEISKSEAASNSISLVPKTVSGWRSR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G50860 Clathrin adaptor complex small... Potri.007G025400 0 1
AT2G22600 RNA-binding KH domain-containi... Potri.007G012000 2.44 0.8698
AT4G29735 unknown protein Potri.004G215200 4.35 0.8845
AT1G71900 Protein of unknown function (D... Potri.013G114100 6.92 0.8722
AT4G31750 WIN2 HOPW1-1-interacting 2 (.1) Potri.006G267600 7.00 0.8255
AT5G09900 RPN5A, MSA, EMB... REGULATORY PARTICLE NON-ATPASE... Potri.005G087100 8.77 0.8574
AT5G62300 Ribosomal protein S10p/S20e fa... Potri.015G129800 8.94 0.8796 RPS20.2
AT1G12390 Cornichon family protein (.1) Potri.003G116400 9.21 0.8497
AT5G05830 RING/FYVE/PHD zinc finger supe... Potri.008G062600 9.32 0.8381
AT3G15395 unknown protein Potri.001G402000 9.48 0.8612
AT1G77350 unknown protein Potri.019G066600 10.95 0.8748

Potri.007G025400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.