Potri.007G026200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G026200.1 pacid=42766587 polypeptide=Potri.007G026200.1.p locus=Potri.007G026200 ID=Potri.007G026200.1.v4.1 annot-version=v4.1
ATGTGTAATTTGTTGGTGGAGAAGGACAGGAAGGAGATGATGCTGGTGTTGGTGTTCGATTTATTTATGAGGATGATGTATAAGATATATATCGGGACCA
GAAGGCCAAGAGGCCAAGGTCTTGTTTATTATCTTTGTCATCCGACCTTTGCCATGACAGGTGCGCTTGCATGGCAGGTCAACCACTATCTTAATAAAAT
TATCATTTTCGTGTTTGGAGGGGAGATCGCACGGGGATTTCCCGGGTTCTCCCCTCTAGTCTCTGTGTCCCGCTTTCTCTTCTCTTTGCCTTACAATCCA
TGGCTAAAGCGCGGCCCCGACTCCAGCTAG
AA sequence
>Potri.007G026200.1 pacid=42766587 polypeptide=Potri.007G026200.1.p locus=Potri.007G026200 ID=Potri.007G026200.1.v4.1 annot-version=v4.1
MCNLLVEKDRKEMMLVLVFDLFMRMMYKIYIGTRRPRGQGLVYYLCHPTFAMTGALAWQVNHYLNKIIIFVFGGEIARGFPGFSPLVSVSRFLFSLPYNP
WLKRGPDSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G026200 0 1
AT2G39970 PXN, PMP38, APE... peroxisomal NAD carrier, perox... Potri.008G064800 2.00 0.8044
AT5G38830 Cysteinyl-tRNA synthetase, cla... Potri.008G122901 4.69 0.7814
AT4G32440 Plant Tudor-like RNA-binding p... Potri.018G030500 5.47 0.7591
AT1G49180 protein kinase family protein ... Potri.019G007200 9.16 0.7510
AT5G15940 NAD(P)-binding Rossmann-fold s... Potri.001G453500 9.53 0.7391
AT5G63520 unknown protein Potri.015G098700 15.29 0.7488
AT1G62930 RPF3 RNA processing factor 3, Tetra... Potri.013G150100 15.58 0.7324
AT5G45030 Trypsin family protein (.1.2) Potri.015G121400 22.24 0.7261
AT2G02710 PLPC, PLPB, PLP... PAS/LOV PROTEIN C, PAS/LOV PRO... Potri.008G180700 24.18 0.7509
AT2G43210 Ubiquitin-like superfamily pro... Potri.007G123800 27.49 0.6760

Potri.007G026200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.