Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36720 252 / 1e-85 HVA22K HVA22-like protein K (.1) AT5G62490 71 / 3e-15 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) AT1G69700 71 / 4e-15 ATHVA22C HVA22 homologue C (.1) AT1G75700 71 / 4e-15 HVA22G HVA22-like protein G (.1) AT1G74520 67 / 6e-14 ATHVA22A HVA22 homologue A (.1) AT5G42560 69 / 8e-14 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) AT2G42820 66 / 2e-13 HVA22F HVA22-like protein F (.1) AT2G36020 67 / 3e-13 HVA22J HVA22-like protein J (.1) AT1G19950 66 / 8e-13 HVA22H HVA22-like protein H (ATHVA22H) (.1) AT4G24960 64 / 8e-13 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G113400 [exp] 250 / 7e-85 AT4G36720 241 / 1e-81 HVA22-like protein K (.1) Potri.015G062800 [exp] 71 / 4e-15 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.012G069300 [exp] 71 / 4e-15 AT1G74520 259 / 1e-89 HVA22 homologue A (.1) Potri.016G072600 [exp] 70 / 1e-14 AT2G36020 210 / 9e-69 HVA22-like protein J (.1) Potri.001G006000 [exp] 67 / 5e-14 AT2G42820 235 / 1e-80 HVA22-like protein F (.1) Potri.005G237900 [exp] 69 / 6e-14 AT5G42560 274 / 1e-91 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.004G166800 [exp] 69 / 9e-14 AT1G75700 234 / 3e-78 HVA22-like protein G (.1) Potri.002G023500 [exp] 67 / 3e-13 AT5G42560 296 / 2e-100 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.006G205300 [exp] 67 / 4e-13 AT2G36020 228 / 1e-74 HVA22-like protein J (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010093 [exp] 201 / 1e-65 AT4G36720 202 / 2e-66 HVA22-like protein K (.1) Lus10007215 [exp] 197 / 2e-64 AT4G36720 196 / 2e-64 HVA22-like protein K (.1) Lus10024234 [exp] 74 / 5e-16 AT1G74520 244 / 5e-83 HVA22 homologue A (.1) Lus10023605 [exp] 74 / 6e-16 AT1G74520 246 / 7e-84 HVA22 homologue A (.1) Lus10016974 [exp] 74 / 1e-15 AT2G36020 210 / 2e-68 HVA22-like protein J (.1) Lus10042193 [exp] 74 / 4e-15 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1) Lus10021299 [exp] 72 / 4e-15 AT2G36020 206 / 6e-67 HVA22-like protein J (.1) Lus10033152 [exp] 72 / 7e-15 AT5G42560 328 / 7e-113 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10034519 [exp] 71 / 2e-14 AT5G42560 324 / 2e-111 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10024332 [exp] 70 / 7e-14 AT5G42560 330 / 9e-114 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [poplar] [flax] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Potri.007G029300.1 pacid=42764866 polypeptide=Potri.007G029300.1.p locus=Potri.007G029300 ID=Potri.007G029300.1.v4.1 annot-version=v4.1 ATGGACAAAAAGTGTCATAAACCCTATTTTCTTGTCAAACACTCAGTTTCACATCTTAAGAAACTCTCTGCTTCGATTCCTATGGCTCTTCTGGGATCCA ACGTAGTAAACGAGGTCGGGTTGCGGTTACTTCTTTGCCCACTTGGATCGAACATTGTAGTAAGAACAGCATGCTGTTCTGTGGGGATTGTTATACCTGT GTACCATACATTCAAAGCAATTGAGAGAAAAGATGAAAATGAGGAACAGAAGTGGCTAATGTACTGGGCAGCATATGGATCTTTCACCCTTGCGGAGGTT TTTACAGACAAGTTGATCTCTTGGTTTCCGATGTATTATCACATGAAGTTTGCTTTTTTGGTGTGGCTTCAACTTCCATCTGCTGAAGGGGCTAAGCAAT TGTATATGAACCACCTGCGTCCTTTCTTATCGAGGCATCAAGCTAGAGTTGATCTGATTATGGGCTTAGCATATGGTGAAATGGTCAAACTCATCAGCAA TCACCAAGCAGAACTTCAATATGCTAAGAGAATGCTTTTGAAGGTTATGGGATCAGCTGACCAAATGTTAAAGGATGCTCCTAATCACCCAGAAGGGCAT CCTGAAGTCCCAGCCATCGAAGAAGAGCAGACAAGAACAATCTTGGATACTGAATCTGATCATGCTGATTGA
AA sequence Show only first row Show all	>Potri.007G029300.1 pacid=42764866 polypeptide=Potri.007G029300.1.p locus=Potri.007G029300 ID=Potri.007G029300.1.v4.1 annot-version=v4.1 MDKKCHKPYFLVKHSVSHLKKLSASIPMALLGSNVVNEVGLRLLLCPLGSNIVVRTACCSVGIVIPVYHTFKAIERKDENEEQKWLMYWAAYGSFTLAEV FTDKLISWFPMYYHMKFAFLVWLQLPSAEGAKQLYMNHLRPFLSRHQARVDLIMGLAYGEMVKLISNHQAELQYAKRMLLKVMGSADQMLKDAPNHPEGH PEVPAIEEEQTRTILDTESDHAD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G36720		HVA22K	HVA22-like protein K (.1)		Potri.007G029300 [exp]	0	1
AT4G16144		AMSH3	associated molecule with the S...		Potri.010G141100 [exp]	5.38	0.6278
AT5G44280		ATRING1A	ARABIDOPSIS THALIANA RING 1A, ...		Potri.011G056300 [exp]	11.48	0.5958
AT2G33980		ATNUDT22	nudix hydrolase homolog 22 (.1...		Potri.004G053300 [exp]	15.55	0.5413
AT5G56350			Pyruvate kinase family protein...		Potri.003G223100 [exp]	24.00	0.5780
AT5G35430			Tetratricopeptide repeat (TPR)...		Potri.018G126100 [exp]	26.38	0.5262
AT4G33690			unknown protein		Potri.001G287900 [exp]	27.78	0.5871
					Potri.004G034301 [exp]	33.31	0.5715
AT4G32960			unknown protein		Potri.018G061800 [exp]	34.20	0.5596
AT1G54290			Translation initiation factor ...		Potri.001G418600 [exp]	41.29	0.5713
AT2G47960			unknown protein		Potri.004G040500 [exp]	43.45	0.5562

Compare expression of checked genes

Potri.007G029300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.