Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66590 192 / 4e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 118 / 4e-34 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 110 / 2e-30 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 109 / 4e-30 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14610 105 / 6e-29 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT3G09590 103 / 4e-28 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 103 / 7e-28 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 102 / 8e-27 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G19990 100 / 1e-26 PR-1-LIKE pathogenesis-related protein-1-like (.1) AT2G14580 99 / 1e-26 ATPRB1 basic pathogenesis-related protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G130100 [exp] 295 / 1e-103 AT5G66590 196 / 3e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083000 [exp] 114 / 2e-32 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 112 / 1e-31 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 112 / 1e-31 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.018G096007 [exp] 112 / 2e-31 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 110 / 4e-31 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 110 / 9e-31 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.018G007000 [exp] 107 / 1e-29 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288600 [exp] 103 / 3e-28 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022481 [exp] 201 / 2e-66 AT5G66590 192 / 6e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10016787 [exp] 199 / 7e-66 AT5G66590 187 / 7e-61 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020491 [exp] 121 / 3e-35 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10013693 [exp] 120 / 9e-35 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10005557 [exp] 120 / 1e-34 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020493 [exp] 117 / 2e-33 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 116 / 5e-33 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 114 / 3e-32 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 112 / 2e-31 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10006980 [exp] 107 / 1e-29 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [poplar] [flax] CAP PF00188 [poplar] [flax] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Potri.007G033200.1 pacid=42766096 polypeptide=Potri.007G033200.1.p locus=Potri.007G033200 ID=Potri.007G033200.1.v4.1 annot-version=v4.1 ATGGCTTACTACTCCTTCCTTCTTGTTCTGGTTCTAGCTTTATTCCACAGCTCAGCCCATGGTGCGGCTCCTGCATCAAGCCACAACCCCACCCAAGTCA CAACAACCCCAATACCACTACCAAATGTAGCTAATGAGTTCCTACAATCTCACAACCAAGCAAGAGCAGCAGTCGGTGTTGGCCCTCTCAAGTGGAGCGA AATGCTAGCCAATGCCACAAGCAGAATAGTCAGATACCAAAGGAACAAAATGGGTTGCCAATTTGCAAACTTGAGCGACAGTAAGTATGGTGGAAATCAG TTATGGTCTAGTACTGGCATGGCTGTGACTCCACGTATGGCTGTTGATAATTGGGTGCAAGAGAAGAATTACTATAACCACACTGGCAATTCCTGTGCGC CAAATCATAGTTGTGGTGTTTACACACAGGTGGTGTGGAGGAAATCTCTGGAGTTGGGGTGTGCACAAGCAACATGTGTGAAGGAGCAAGCTAGCTTAAC TATATGTTATTATGACCCACCTGGGAATATTATAGGGGAAAGCCCATACTAG
AA sequence Show only first row Show all	>Potri.007G033200.1 pacid=42766096 polypeptide=Potri.007G033200.1.p locus=Potri.007G033200 ID=Potri.007G033200.1.v4.1 annot-version=v4.1 MAYYSFLLVLVLALFHSSAHGAAPASSHNPTQVTTTPIPLPNVANEFLQSHNQARAAVGVGPLKWSEMLANATSRIVRYQRNKMGCQFANLSDSKYGGNQ LWSSTGMAVTPRMAVDNWVQEKNYYNHTGNSCAPNHSCGVYTQVVWRKSLELGCAQATCVKEQASLTICYYDPPGNIIGESPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G66590			CAP (Cysteine-rich secretory p...		Potri.007G033200 [exp]	0	1
AT5G20820			SAUR-like auxin-responsive pro...		Potri.006G137000 [exp]	2.00	0.7647	SAUR6
AT5G44680			DNA glycosylase superfamily pr...		Potri.008G081000 [exp]	8.94	0.7242
AT1G65900			unknown protein		Potri.017G139400 [exp]	10.19	0.7468
AT4G34760			SAUR-like auxin-responsive pro...		Potri.004G164400 [exp]	13.85	0.7299	SAUR29
AT2G22490		CYCD2;1, ATCYCD...	Cyclin D2;1 (.1.2)		Potri.001G292300 [exp]	24.00	0.7291
AT2G17950	HD	WUS1, PGA6, WUS	WUSCHEL 1, WUSCHEL, Homeodomai...		Potri.007G012100 [exp]	26.26	0.6470
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Potri.003G150600 [exp]	27.23	0.6041
AT1G29500			SAUR-like auxin-responsive pro...		Potri.017G043600 [exp]	33.85	0.6790	SAUR56
AT1G53700		PK3AT, WAG1	PROTEIN KINASE 3 ARABIDOPSIS T...		Potri.011G139800 [exp]	44.12	0.6257	Pt-PSPK3.2
AT1G56280		ATDI19	drought-induced 19 (.1.2)		Potri.012G086500 [exp]	51.66	0.5889

Compare expression of checked genes

Potri.007G033200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.