Potri.007G034000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G130750 90 / 2e-25 ND /
Potri.005G150300 60 / 9e-14 ND /
Potri.001G000450 59 / 7e-13 ND /
Potri.007G034101 51 / 4e-10 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028245 59 / 5e-13 ND /
PFAM info
Representative CDS sequence
>Potri.007G034000.8 pacid=42766168 polypeptide=Potri.007G034000.8.p locus=Potri.007G034000 ID=Potri.007G034000.8.v4.1 annot-version=v4.1
ATGTGCTACAAAGTAACGTGCAAGCAATGCAATAAATATTCCTGGGGTGGGTGTGGCAACCACCTCACCGCCGTGTATGCGGGCATAGAGAAGGGAAAGC
ACTGCACGTGCAAGCCATGGCCGGGGGTTGTCATCCTTACGGAGGAGACAGCTGCCGAGCAACAACCATATAGAGCTTTATCAGCTAATTCAGCTACCAA
GGCGGCTGCAGATGCAAGGCATCATCGCAGATGGTGGCGTGTCTAG
AA sequence
>Potri.007G034000.8 pacid=42766168 polypeptide=Potri.007G034000.8.p locus=Potri.007G034000 ID=Potri.007G034000.8.v4.1 annot-version=v4.1
MCYKVTCKQCNKYSWGGCGNHLTAVYAGIEKGKHCTCKPWPGVVILTEETAAEQQPYRALSANSATKAAADARHHRRWWRV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G034000 0 1
AT4G08300 nodulin MtN21 /EamA-like trans... Potri.005G176200 2.00 0.9984
Potri.007G034101 2.44 0.9983
AT3G16360 AHP4 HPT phosphotransmitter 4 (.1.2... Potri.001G189900 4.89 0.9983
Potri.005G168401 5.47 0.9978
AT1G32250 Calcium-binding EF-hand family... Potri.014G030200 7.48 0.9831
AT3G03430 Calcium-binding EF-hand family... Potri.014G030800 7.54 0.9722
AT2G16050 Cysteine/Histidine-rich C1 dom... Potri.009G170201 8.24 0.9746
AT3G30340 nodulin MtN21 /EamA-like trans... Potri.014G108500 8.36 0.9865
Potri.009G081850 8.77 0.9864
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Potri.005G228000 8.94 0.9754

Potri.007G034000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.