Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19080 119 / 2e-32 SWIB complex BAF60b domain-containing protein (.1) AT4G22360 73 / 1e-15 SWIB complex BAF60b domain-containing protein (.1) AT1G49520 62 / 1e-11 SWIB complex BAF60b domain-containing protein (.1) AT2G35605 54 / 3e-10 SWIB/MDM2 domain superfamily protein (.1) AT3G03590 54 / 8e-10 SWIB/MDM2 domain superfamily protein (.1) AT1G31760 52 / 2e-09 SWIB/MDM2 domain superfamily protein (.1) AT4G34290 52 / 8e-09 SWIB/MDM2 domain superfamily protein (.1) AT2G14880 50 / 4e-08 SWIB/MDM2 domain superfamily protein (.1) AT4G26810 44 / 4e-06 SWIB/MDM2 domain superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G134500 [exp] 172 / 2e-53 AT3G19080 226 / 3e-70 SWIB complex BAF60b domain-containing protein (.1) Potri.009G106700 [exp] 76 / 1e-16 AT1G49520 301 / 5e-100 SWIB complex BAF60b domain-containing protein (.1) Potri.006G010700 [exp] 69 / 3e-14 AT4G22360 303 / 2e-100 SWIB complex BAF60b domain-containing protein (.1) Potri.016G013400 [exp] 65 / 8e-13 AT4G22360 301 / 1e-99 SWIB complex BAF60b domain-containing protein (.1) Potri.013G070600 [exp] 56 / 2e-10 AT2G35605 108 / 2e-31 SWIB/MDM2 domain superfamily protein (.1) Potri.004G145200 [exp] 56 / 8e-10 AT1G49520 308 / 6e-103 SWIB complex BAF60b domain-containing protein (.1) Potri.001G297400 [exp] 53 / 2e-09 AT2G14880 142 / 3e-44 SWIB/MDM2 domain superfamily protein (.1) Potri.009G092200 [exp] 51 / 1e-08 AT2G14880 169 / 7e-55 SWIB/MDM2 domain superfamily protein (.1) Potri.015G137600 [exp] 43 / 7e-06 AT4G26810 181 / 1e-60 SWIB/MDM2 domain superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009333 [exp] 145 / 3e-43 AT3G19080 266 / 4e-87 SWIB complex BAF60b domain-containing protein (.1) Lus10019640 [exp] 142 / 2e-41 AT3G19080 256 / 2e-81 SWIB complex BAF60b domain-containing protein (.1) Lus10016581 [exp] 56 / 9e-10 AT4G22360 190 / 1e-55 SWIB complex BAF60b domain-containing protein (.1) Lus10014892 [exp] 56 / 9e-10 AT4G22360 243 / 2e-76 SWIB complex BAF60b domain-containing protein (.1) Lus10013893 [exp] 52 / 6e-09 AT2G14880 143 / 7e-45 SWIB/MDM2 domain superfamily protein (.1) Lus10005667 [exp] 51 / 1e-08 AT3G03590 118 / 4e-35 SWIB/MDM2 domain superfamily protein (.1) Lus10002106 [exp] 48 / 5e-08 AT4G34290 109 / 2e-32 SWIB/MDM2 domain superfamily protein (.1) Lus10038799 [exp] 42 / 4e-05 AT4G26810 160 / 1e-50 SWIB/MDM2 domain superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02201 [poplar] [flax] SWIB SWIB/MDM2 domain
Representative CDS sequence Show only first row Show all	>Potri.007G039350.1 pacid=42766045 polypeptide=Potri.007G039350.1.p locus=Potri.007G039350 ID=Potri.007G039350.1.v4.1 annot-version=v4.1 ATGATATATTATTATTATTTTGCTGTTGCCCCTCCAAAGTCCAAGCTATGCATCTGCTGCTCATTCAATGTTGAACAACAGGAGAAGAATTTGCAAGATC CGAGTGATAGACGGAAAATAAATTGTGACAAGCCATTGCAGGCTCTTTTCGGTGTCGATTCCATCAACATGTTTCAAATGACCAAACGGGAAAAAGAGAA GCATAAGGGAGGAAATTCAGGCTTTCTTGCCCCACTTCAACATTCATATGCTTTAATAAAGCTCCTTGGTACTGGAAAAAGTTCATTATCACGATCTGAT GTTGTCAAGAGAATTTGGGAATGCATAAAGCAAAACAATCTCCAGGATCCATCTGACAAGAGGAGAATACCATGTGATGTGAAGCTGAAAGAACTCTTTG ACATTGACTGCTCCAAAACTCTTTTCCGTTCATTCTGTGAAGGCCTAACAGTGAGTTGCTCGTGA
AA sequence Show only first row Show all	>Potri.007G039350.1 pacid=42766045 polypeptide=Potri.007G039350.1.p locus=Potri.007G039350 ID=Potri.007G039350.1.v4.1 annot-version=v4.1 MIYYYYFAVAPPKSKLCICCSFNVEQQEKNLQDPSDRRKINCDKPLQALFGVDSINMFQMTKREKEKHKGGNSGFLAPLQHSYALIKLLGTGKSSLSRSD VVKRIWECIKQNNLQDPSDKRRIPCDVKLKELFDIDCSKTLFRSFCEGLTVSCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19080			SWIB complex BAF60b domain-con...		Potri.007G039350 [exp]	0	1
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Potri.001G256600 [exp]	8.77	0.9075
AT1G24400		ATLHT2, AATL2, ...	ARABIDOPSIS LYSINE HISTIDINE T...		Potri.008G179000 [exp]	10.95	0.8792
AT5G53540			P-loop containing nucleoside t...		Potri.012G022985 [exp]	11.22	0.8844
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Potri.006G001600 [exp]	13.67	0.8488
AT3G56180			Protein of unknown function (D...		Potri.008G075100 [exp]	22.97	0.8496
AT3G63470		SCPL40	serine carboxypeptidase-like 4...		Potri.001G261104 [exp]	23.36	0.8575
AT1G78400			Pectin lyase-like superfamily ...		Potri.001G377700 [exp]	27.71	0.9219
AT5G20240	MADS	PI, PISTILLATA	PISTILLATA, K-box region and M...		Potri.005G182200 [exp]	31.17	0.8122	Pt-MADS2.2
					Potri.003G026712 [exp]	39.39	0.8869
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Potri.013G012666 [exp]	40.89	0.7967

Compare expression of checked genes

Potri.007G039350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.