Potri.007G040950 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G040950.1 pacid=42764893 polypeptide=Potri.007G040950.1.p locus=Potri.007G040950 ID=Potri.007G040950.1.v4.1 annot-version=v4.1
ATGTGGGCATCATTAATCTTCAAAGAGTTTACAACATCGGCGTTATTTCACAAAACAGTTATAAAAGCATTTCTGTACAAACAAAAGATCGTAATAGAAA
GAGAAGGAAGGCAACAGCAAGAGGCAAAAGATACACCTTATCTTCAGAACATATTAGACCAGCTAAGCAAACTTCGAGAACCTCTAATCAAATCCAAGCA
CGTGGAGCCACATATTTTTCCATGGAAGAGGGGGGAAAGGACATACCGGGATAAGCAATTCTGTCAACTAAGATGCTACGGGATTTGA
AA sequence
>Potri.007G040950.1 pacid=42764893 polypeptide=Potri.007G040950.1.p locus=Potri.007G040950 ID=Potri.007G040950.1.v4.1 annot-version=v4.1
MWASLIFKEFTTSALFHKTVIKAFLYKQKIVIEREGRQQQEAKDTPYLQNILDQLSKLREPLIKSKHVEPHIFPWKRGERTYRDKQFCQLRCYGI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G040950 0 1
AT5G05800 unknown protein Potri.014G061450 5.47 0.9997
Potri.008G135001 6.00 0.9982
AT3G04380 SDG31, SUVR4 SET DOMAIN PROTEIN 31, SET-dom... Potri.009G138600 6.16 0.9980
Potri.015G004900 8.12 0.9967
Potri.009G020201 8.36 0.9997
AT1G30870 Peroxidase superfamily protein... Potri.010G175100 10.00 0.9996
AT5G44120 ATCRA1, CRU1, C... CRUCIFERINA, RmlC-like cupins ... Potri.005G224700 10.48 0.9994 GY4.2
AT4G11720 HAP2, GCS1 GENERATIVE CELL-SPECIFIC 1, ha... Potri.001G109000 11.35 0.9899
Potri.009G036600 12.24 0.9990
Potri.003G081133 12.96 0.9904

Potri.007G040950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.