Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23440 54 / 3e-11 unknown protein AT5G66816 40 / 3e-05 unknown protein AT1G47485 39 / 3e-05 unknown protein AT5G66815 39 / 4e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G041400 [exp] 54 / 5e-11 AT2G23440 45 / 2e-07 unknown protein Potri.005G136800 [exp] 47 / 3e-08 AT5G66816 45 / 4e-07 unknown protein Potri.007G042000 [exp] 46 / 9e-08 AT5G66816 43 / 2e-06 unknown protein Potri.014G034500 [exp] 38 / 8e-05 AT5G66815 43 / 1e-06 unknown protein Potri.005G136700 [exp] 39 / 0.0002 AT3G50610 78 / 1e-16 unknown protein Potri.004G234800 [exp] 37 / 0.0003 AT2G35612 64 / 6e-15 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002969 [exp] 50 / 1e-09 AT2G23440 44 / 7e-07 unknown protein Lus10009345 [exp] 49 / 7e-09 AT2G23440 42 / 1e-06 unknown protein Lus10009347 [exp] 42 / 2e-06 AT2G23440 50 / 2e-09 unknown protein Lus10033285 [exp] 37 / 0.0008 AT2G35612 42 / 1e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.007G041500.1 pacid=42765503 polypeptide=Potri.007G041500.1.p locus=Potri.007G041500 ID=Potri.007G041500.1.v4.1 annot-version=v4.1 ATGGCCAATGCAGCTTGCACTTGCTTGTTTTTCTTACTAATGTTGTTGTCTTACAATATCCTTTGTGTTGAAGGAAGGAGTTTAGAACTGAAAAAAGCAT TGAAGCATGCCAAACGCTGCAATCCTGGAGGGAAGAGCATCGAAAGAAACACTTTATTAAATAGTGCAAGCCCAAGTAATCACTTGCACCATACTGTTAA AACTAGTGATGGATTCGTGGAGGCTTTTCGACCAACAAACCCTGGTCATAGTCCAGGTGTTGGCCATTCCGTCCACAACTAA
AA sequence Show only first row Show all	>Potri.007G041500.1 pacid=42765503 polypeptide=Potri.007G041500.1.p locus=Potri.007G041500 ID=Potri.007G041500.1.v4.1 annot-version=v4.1 MANAACTCLFFLLMLLSYNILCVEGRSLELKKALKHAKRCNPGGKSIERNTLLNSASPSNHLHHTVKTSDGFVEAFRPTNPGHSPGVGHSVHN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G23440			unknown protein		Potri.007G041500 [exp]	0	1
AT5G14650			Pectin lyase-like superfamily ...		Potri.001G346800 [exp]	3.60	0.9803
AT1G12100			Bifunctional inhibitor/lipid-t...		Potri.001G121800 [exp]	6.92	0.9757
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Potri.004G156300 [exp]	9.16	0.9736
					Potri.011G167566 [exp]	10.19	0.8994
AT1G64780		ATAMT1;2	ammonium transporter 1;2 (.1)		Potri.019G023600 [exp]	10.39	0.9722
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.002G080400 [exp]	10.90	0.9578
AT4G26010			Peroxidase superfamily protein...		Potri.013G066800 [exp]	12.96	0.9634
AT3G07870			F-box and associated interacti...		Potri.008G216223 [exp]	13.00	0.8582
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181000 [exp]	13.41	0.9638
AT1G52570		PLDALPHA2	phospholipase D alpha 2 (.1)		Potri.018G131200 [exp]	16.15	0.9614

Compare expression of checked genes

Potri.007G041500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.