Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66400 40 / 4e-05 CML23 calmodulin like 23 (.1) AT3G59440 40 / 5e-05 Calcium-binding EF-hand family protein (.1) AT2G43290 40 / 9e-05 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) AT5G37770 37 / 0.0004 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT3G03400 37 / 0.0008 EF hand calcium-binding protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G030900 [exp] 87 / 1e-23 AT1G66400 41 / 2e-05 calmodulin like 23 (.1) Potri.014G030800 [exp] 78 / 2e-20 AT3G03430 40 / 9e-06 Calcium-binding EF-hand family protein (.1) Potri.014G030500 [exp] 75 / 5e-19 ND / Potri.002G127000 [exp] 74 / 8e-19 AT4G25970 44 / 2e-06 phosphatidylserine decarboxylase 3 (.1) Potri.014G030700 [exp] 58 / 3e-12 ND / Potri.008G079066 [exp] 49 / 7e-09 AT2G43290 48 / 8e-08 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.008G079132 [exp] 48 / 2e-08 AT1G05990 45 / 5e-07 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) Potri.012G048200 [exp] 44 / 2e-06 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2) Potri.014G030100 [exp] 43 / 2e-06 AT1G18210 54 / 2e-10 Calcium-binding EF-hand family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021732 [exp] 81 / 3e-21 AT1G66400 49 / 3e-08 calmodulin like 23 (.1) Lus10028657 [exp] 41 / 2e-05 AT1G21550 122 / 9e-36 Calcium-binding EF-hand family protein (.1) Lus10017537 [exp] 41 / 4e-05 AT4G23650 803 / 0.0 Calcium dependent protein kinase 3, calcium-dependent protein kinase 6 (.1) Lus10000972 [exp] 38 / 0.0004 AT1G21550 128 / 3e-38 Calcium-binding EF-hand family protein (.1) Lus10004807 [exp] 38 / 0.0004 AT3G51850 986 / 0.0 calcium-dependent protein kinase 13 (.1) Lus10042761 [exp] 37 / 0.0009 AT1G21550 70 / 7e-16 Calcium-binding EF-hand family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13202 [poplar] [flax] EF-hand_5 EF hand
Representative CDS sequence Show only first row Show all	>Potri.007G042700.2 pacid=42765067 polypeptide=Potri.007G042700.2.p locus=Potri.007G042700 ID=Potri.007G042700.2.v4.1 annot-version=v4.1 ATGGCCATAATGTGTTGTTTTCAATTGAATCCCAACCGTGAAATGACGGTGGAAGATTTCAAAGCCTGGCTTCGTCAGTTTGAAATGGACAACGATGGAC GTGTTAGCCATGAAGAGCTAAAAGAGGCTATTCAAAGCTTGAGGGTCTGGTTTCCTTGGTGGAAGGCTCGGCAGGTCATGAAGGTAGCTGATACCAATCA CAATGGTCAAATAGAAGGTGTAGAAGAAATCGAGAAGCTTGTGAACTATGCTCAACAACATTTGCACATGAAAATTCATCGAAGCCATGGTAGGTGGTGA
AA sequence Show only first row Show all	>Potri.007G042700.2 pacid=42765067 polypeptide=Potri.007G042700.2.p locus=Potri.007G042700 ID=Potri.007G042700.2.v4.1 annot-version=v4.1 MAIMCCFQLNPNREMTVEDFKAWLRQFEMDNDGRVSHEELKEAIQSLRVWFPWWKARQVMKVADTNHNGQIEGVEEIEKLVNYAQQHLHMKIHRSHGRW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G20410		CPK9	calmodulin-domain protein kina...		Potri.007G042700 [exp]	0	1
AT1G10380			Putative membrane lipoprotein ...		Potri.010G040500 [exp]	1.41	0.9126
AT5G04080			unknown protein		Potri.006G043300 [exp]	5.29	0.8782
AT1G10380			Putative membrane lipoprotein ...		Potri.007G094800 [exp]	10.77	0.8627
AT4G16790			hydroxyproline-rich glycoprote...		Potri.003G079900 [exp]	13.22	0.8527
AT5G64530	NAC	ANAC104, XND1	Arabidopsis NAC domain contain...		Potri.007G105000 [exp]	15.55	0.8305
AT3G55370	DOF	OBP3, AtDof3. 6	OBF-binding protein 3 (.1.2.3)		Potri.008G055100 [exp]	15.65	0.8434
					Potri.007G005400 [exp]	16.88	0.8044
AT5G02460	DOF	AtDof5. 1	Dof-type zinc finger DNA-bindi...		Potri.009G029500 [exp]	17.29	0.8286
					Potri.011G165300 [exp]	17.32	0.8312
AT3G21460			Glutaredoxin family protein (....		Potri.008G214500 [exp]	18.33	0.7463

Compare expression of checked genes

Potri.007G042700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.