Potri.007G042800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14870 153 / 5e-48 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1)
AT5G35525 152 / 1e-47 PLAC8 family protein (.1)
AT1G14880 138 / 3e-42 AtPCR1, PCR1 PLANT CADMIUM RESISTANCE 1 (.1)
AT1G68610 132 / 1e-39 PCR11 PLANT CADMIUM RESISTANCE 11 (.1)
AT1G68630 129 / 2e-38 PLAC8 family protein (.1)
AT3G18470 128 / 2e-38 PLAC8 family protein (.1)
AT3G18460 128 / 9e-38 PLAC8 family protein (.1)
AT1G49030 127 / 7e-37 PLAC8 family protein (.1)
AT3G18450 120 / 7e-35 PLAC8 family protein (.1)
AT1G58320 104 / 9e-29 PLAC8 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G092200 208 / 3e-69 AT1G14870 164 / 2e-52 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G127700 176 / 2e-56 AT1G68610 174 / 5e-56 PLANT CADMIUM RESISTANCE 11 (.1)
Potri.008G132850 173 / 2e-55 AT1G14870 184 / 6e-60 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G109100 172 / 5e-55 AT1G14870 165 / 1e-52 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.008G132775 169 / 7e-54 AT1G14870 185 / 2e-60 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.008G132900 169 / 7e-54 AT1G14870 189 / 7e-62 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G108800 162 / 3e-51 AT1G14870 179 / 8e-58 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.010G108900 160 / 6e-50 AT1G14870 142 / 4e-43 PLANT CADMIUM RESISTANCE 2 (.1)
Potri.012G060900 139 / 5e-40 AT1G49030 199 / 2e-62 PLAC8 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021696 163 / 2e-51 AT1G14870 177 / 5e-57 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10043325 161 / 1e-50 AT1G14870 187 / 4e-61 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10034298 155 / 1e-48 AT1G14870 160 / 7e-51 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10019478 152 / 4e-47 AT1G14870 184 / 7e-60 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10004063 127 / 9e-38 AT1G68630 132 / 2e-40 PLAC8 family protein (.1)
Lus10009036 117 / 9e-34 AT1G68630 122 / 2e-36 PLAC8 family protein (.1)
Lus10041474 116 / 2e-33 AT1G14870 112 / 3e-32 PLANT CADMIUM RESISTANCE 2 (.1)
Lus10008890 112 / 4e-32 AT1G68630 119 / 6e-35 PLAC8 family protein (.1)
Lus10004064 101 / 5e-25 AT4G30040 156 / 3e-41 Eukaryotic aspartyl protease family protein (.1)
Lus10005257 94 / 3e-24 AT2G40935 228 / 6e-77 PLAC8 family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04749 PLAC8 PLAC8 family
Representative CDS sequence
>Potri.007G042800.2 pacid=42766700 polypeptide=Potri.007G042800.2.p locus=Potri.007G042800 ID=Potri.007G042800.2.v4.1 annot-version=v4.1
ATGCATCCTCCAGTATATCAAGACAACCCAAAATATGCACCCCAAGGGTATCCAATGAACATCTCTACTAGACAACCTTACCCTCCATATATCTCCTCAG
CCACCGCCACCGCAACACGGTGGTCTACTGGTCTTTGCCATTGTTGCGATGACCCGGCAAATTGTCTCGTTACTTGCATGTGTCCATGTGTTACCTTTGA
ACAAATTGCTGAGGTAGTCAATAAGGGTTCAATATCTTATGCAGCAAGTGGTGCAGTTTATGGTCTGCTGCTGGGTTTTACAGGTTTGTCATGCTTGTAC
TCGTGCTTCTATCGGTCAAGATTGAGAGGACAATATGACTTGGAAGAGGCTCCTTGTGTAGATTGCTTGGTTCACTTCTTCTATGAGCCTTGTGCACTTT
GTCAGGAATATAGAGAACTCAGGAATCGTGGTTTTGATATGGGGATTGGTTGGCACGCTAACATGGATAGACAAAACAGGGGAATTACAGTTGCCCCTCC
AGTTGTTGGTGGGGGCATGAGCAGATGA
AA sequence
>Potri.007G042800.2 pacid=42766700 polypeptide=Potri.007G042800.2.p locus=Potri.007G042800 ID=Potri.007G042800.2.v4.1 annot-version=v4.1
MHPPVYQDNPKYAPQGYPMNISTRQPYPPYISSATATATRWSTGLCHCCDDPANCLVTCMCPCVTFEQIAEVVNKGSISYAASGAVYGLLLGFTGLSCLY
SCFYRSRLRGQYDLEEAPCVDCLVHFFYEPCALCQEYRELRNRGFDMGIGWHANMDRQNRGITVAPPVVGGGMSR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G14870 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1... Potri.007G042800 0 1

Potri.007G042800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.