Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67140 151 / 2e-47 F-box/RNI-like superfamily protein (.1) AT1G21760 39 / 0.0002 ATFBP7 F-box protein 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G140000 [exp] 180 / 7e-59 AT5G67140 334 / 2e-117 F-box/RNI-like superfamily protein (.1) Potri.004G203300 [exp] 40 / 6e-05 AT1G67190 654 / 0.0 F-box/RNI-like superfamily protein (.1.2) Potri.002G082500 [exp] 37 / 0.0008 AT1G21760 474 / 7e-170 F-box protein 7 (.1) Potri.005G178600 [exp] 37 / 0.0008 AT1G21760 479 / 6e-172 F-box protein 7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039564 [exp] 137 / 8e-42 AT5G67140 317 / 1e-110 F-box/RNI-like superfamily protein (.1) Lus10024178 [exp] 98 / 1e-26 AT5G67140 271 / 4e-93 F-box/RNI-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [poplar] [flax] F-box PF12937 [poplar] [flax] F-box-like F-box-like
Representative CDS sequence Show only first row Show all	>Potri.007G045601.1 pacid=42765633 polypeptide=Potri.007G045601.1.p locus=Potri.007G045601 ID=Potri.007G045601.1.v4.1 annot-version=v4.1 ATGGAGAAGGAAGAGGCAGGGATTGATCGTTTACCAATAGACTTGCTGGCTTACATATTTGGTTTGATAACTCCCTTCACTGATTTAGCCCAGGCAAGTA GTGTTTGCAGGAAATGGAAAGAAGGGGTGAAGCAATCTTTGGCACAAAGAAACAGCTTGAGCTTTTCTGGTTGGAAGATGGATGATGACTCCACTACCCG TCTTGTTCGCCTTGCTTACAACCTTAAAGAACTCGATATGAGCCGGTGGGGTTGCCAGATAACTGACAATGGACTGTACCAAATTTCTTTGGCAAACTGA
AA sequence Show only first row Show all	>Potri.007G045601.1 pacid=42765633 polypeptide=Potri.007G045601.1.p locus=Potri.007G045601 ID=Potri.007G045601.1.v4.1 annot-version=v4.1 MEKEEAGIDRLPIDLLAYIFGLITPFTDLAQASSVCRKWKEGVKQSLAQRNSLSFSGWKMDDDSTTRLVRLAYNLKELDMSRWGCQITDNGLYQISLAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G67140			F-box/RNI-like superfamily pro...		Potri.007G045601 [exp]	0	1
AT4G38360		LAZ1	LAZARUS 1, Protein of unknown ...		Potri.004G204600 [exp]	1.73	0.8595
AT4G10270			Wound-responsive family protei...		Potri.019G116700 [exp]	21.14	0.8548
					Potri.006G001701 [exp]	30.29	0.7740
AT3G12480	CCAAT	NF-YC11	"nuclear factor Y, subunit C11...		Potri.003G192100 [exp]	31.40	0.8128
					Potri.001G035450 [exp]	34.69	0.8419
AT2G15890		MEE14	maternal effect embryo arrest ...		Potri.009G108200 [exp]	35.79	0.8191
AT5G40160		EMB139, EMB506	embryo defective 506, EMBRYO D...		Potri.001G295200 [exp]	37.34	0.8436
AT4G35750			SEC14 cytosolic factor family ...		Potri.002G014700 [exp]	53.66	0.7974
AT1G65770		AMR1	ascorbic acid mannose pathway ...		Potri.005G105400 [exp]	57.70	0.8204
AT5G02250		ATMTRNASEII, RN...	ribonucleotide reductase 1, EM...		Potri.006G086200 [exp]	57.72	0.8297

Compare expression of checked genes

Potri.007G045601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.