Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-DIN11.1,2OGox15
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50210 502 / 1e-180 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49630 445 / 4e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G49620 437 / 3e-154 DIN11 DARK INDUCIBLE 11, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16770 146 / 3e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19010 142 / 2e-39 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT1G35190 137 / 7e-38 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G05600 134 / 2e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 132 / 5e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G46490 129 / 6e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19000 129 / 1e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G086800 [exp] 163 / 1e-47 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107550 [exp] 152 / 2e-43 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107600 [exp] 152 / 3e-43 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.018G086900 [exp] 148 / 8e-42 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146000 [exp] 144 / 6e-40 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 142 / 3e-39 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G201000 [exp] 137 / 2e-37 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 135 / 8e-37 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G079600 [exp] 134 / 1e-36 AT4G16770 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006259 [exp] 423 / 3e-149 AT3G50210 386 / 5e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10041597 [exp] 200 / 2e-63 AT3G50210 177 / 1e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10021002 [exp] 150 / 3e-42 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10012963 [exp] 144 / 3e-40 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10034964 [exp] 140 / 8e-39 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023851 [exp] 135 / 5e-37 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004746 [exp] 133 / 3e-36 AT4G16770 370 / 7e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 129 / 3e-34 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005037 [exp] 128 / 6e-34 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023602 [exp] 126 / 1e-33 AT3G11180 158 / 5e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.007G047100.6 pacid=42765317 polypeptide=Potri.007G047100.6.p locus=Potri.007G047100 ID=Potri.007G047100.6.v4.1 annot-version=v4.1 ATGGCAACCGACTTCAAATCAATCCCAATTATAGATATTAGTCCATTAGTGGCAAAGTGTGATGATCCGAAGAGAGTTCAAGACCCAGATGTTCTTGAAG TTGTTGGACAATTAGACCAGGCTTGTAGAGAAGCTGGATTCTTCTATGTGAAGGGACATGGTATACCCGATTCCCTCATTAAAGATGTTAAGAATGTGAC ACGCAAATTTTTTGATCTTCCCTATGAAGAAAAGTTGAAAATCAAGTTGAGTGCTGCTGCTGGATACAGGGGATATCAGAGGATCGGAGAAAACATAACC AAAGGCATTCCTGATATGCATGAAGCCATCGATTGTTATAGAGAGGTAACACCAGGGATGTATGGAGCGCTTGGCAAGATCATTGAAGGAGTTAATCAAT GGCCACATGATCCACCTTATTTCAAAGTACTGATGGAGGAGTATATCAGCTTTTGCACAGACTTGTCAAGAAAAATTATGCGGGGAATTGCTCTGGCATT GGGTGGATCAGCTGATGAATTTGAAGGTGAACGAGCTGGAGATGCATTTTGGGTGTTGCGTGTCATTGGTTATCCAGGTGTTTCCAATACAAATGGCCAA AATGCACCTGAAAACGACATAGGATGTGGAGCTCACACAGACTATGGTTTGATGACATTGGTCAATCAGGATGATGGTATTACCGCACTTCAGGTGAGAA ACCTGTCTGGTGAGTGGATATCTGCCCCTCCAATTCCGGGAACATTTGTATGCAACATTGGAGATATGCTGAAGATTTGGTCTAATGGTATGTATGATTC CACTCTGCACCGAGTTATCAACACTTCTCCAAAATATCGGGCCTGCGTAGCTTATTTCTACGAGCCCAACTTCGATGCTGCAGTGGAGCCTTTAGATATT TGTAAGGAGAAGACTGGAGGTATTAAGAAGTTTGGAAAAGCCGTTTATGGAGAGCATCTAGCAAGCAAACTTGAAACCAATTTTGTTTGA
AA sequence Show only first row Show all	>Potri.007G047100.6 pacid=42765317 polypeptide=Potri.007G047100.6.p locus=Potri.007G047100 ID=Potri.007G047100.6.v4.1 annot-version=v4.1 MATDFKSIPIIDISPLVAKCDDPKRVQDPDVLEVVGQLDQACREAGFFYVKGHGIPDSLIKDVKNVTRKFFDLPYEEKLKIKLSAAAGYRGYQRIGENIT KGIPDMHEAIDCYREVTPGMYGALGKIIEGVNQWPHDPPYFKVLMEEYISFCTDLSRKIMRGIALALGGSADEFEGERAGDAFWVLRVIGYPGVSNTNGQ NAPENDIGCGAHTDYGLMTLVNQDDGITALQVRNLSGEWISAPPIPGTFVCNIGDMLKIWSNGMYDSTLHRVINTSPKYRACVAYFYEPNFDAAVEPLDI CKEKTGGIKKFGKAVYGEHLASKLETNFV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G50210			2-oxoglutarate (2OG) and Fe(II...		Potri.007G047100 [exp]	0	1	Pt-DIN11.1,2OGox15
AT2G23420		NAPRT2	nicotinate phosphoribosyltrans...		Potri.005G139800 [exp]	6.48	0.7345
AT5G18230			transcription regulator NOT2/N...		Potri.019G032800 [exp]	8.12	0.7093
AT5G42520	BBR_BPC	BPC6, BBR/BPC6,...	ARABIDOPSIS THALIANA BASIC PEN...		Potri.005G235900 [exp]	8.66	0.6881
					Potri.013G032900 [exp]	12.64	0.7410
AT2G38740			Haloacid dehalogenase-like hyd...		Potri.001G147400 [exp]	20.00	0.7207
AT2G18850			SET domain-containing protein ...		Potri.006G168900 [exp]	28.14	0.6428
AT1G76040		CPK29	calcium-dependent protein kina...		Potri.005G245000 [exp]	30.13	0.7215
AT2G03070		MED8	mediator subunit 8 (.1)		Potri.010G253100 [exp]	36.52	0.6816
AT5G38280		PR5K	PR5-like receptor kinase (.1)		Potri.004G014200 [exp]	42.32	0.6985
AT5G47750		PK5, D6PKL2	D6 protein kinase like 2 (.1)		Potri.006G003800 [exp]	47.32	0.6655	Pt-CCSPK1.2

Compare expression of checked genes

Potri.007G047100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.