Potri.007G047800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39220 194 / 2e-63 ATRER1A Rer1 family protein (.1)
AT2G23310 189 / 4e-61 ATRER1C1, ATRER1C Rer1 family protein (.1.2)
AT2G21600 186 / 7e-60 ATRER1B endoplasmatic reticulum retrieval protein 1B (.1)
AT2G18240 147 / 2e-44 Rer1 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G141700 253 / 2e-86 AT2G23310 200 / 2e-65 Rer1 family protein (.1.2)
Potri.002G034200 192 / 2e-62 AT2G21600 265 / 3e-91 endoplasmatic reticulum retrieval protein 1B (.1)
Potri.004G156900 188 / 7e-61 AT4G39220 245 / 1e-83 Rer1 family protein (.1)
Potri.005G228900 187 / 1e-60 AT2G21600 235 / 1e-79 endoplasmatic reticulum retrieval protein 1B (.1)
Potri.009G118500 182 / 1e-58 AT4G39220 224 / 2e-75 Rer1 family protein (.1)
Potri.004G156800 146 / 2e-44 AT4G39220 251 / 6e-86 Rer1 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019323 206 / 9e-68 AT4G39220 259 / 6e-89 Rer1 family protein (.1)
Lus10011502 204 / 4e-67 AT4G39220 258 / 3e-88 Rer1 family protein (.1)
Lus10028317 177 / 4e-56 AT4G39220 254 / 8e-87 Rer1 family protein (.1)
Lus10041765 173 / 1e-54 AT4G39220 250 / 5e-85 Rer1 family protein (.1)
Lus10028319 169 / 1e-53 AT2G21600 249 / 4e-85 endoplasmatic reticulum retrieval protein 1B (.1)
Lus10041766 169 / 2e-53 AT2G21600 248 / 7e-85 endoplasmatic reticulum retrieval protein 1B (.1)
Lus10002890 54 / 8e-10 AT4G39220 112 / 7e-33 Rer1 family protein (.1)
Lus10002889 54 / 1e-09 AT4G39220 119 / 4e-35 Rer1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03248 Rer1 Rer1 family
Representative CDS sequence
>Potri.007G047800.1 pacid=42766219 polypeptide=Potri.007G047800.1.p locus=Potri.007G047800 ID=Potri.007G047800.1.v4.1 annot-version=v4.1
ATGGAAGCCGGGCAGCCAAGCGGGACTCTTTCAGTAGACGATCTGTCCTCTCTATCATCAACCCCAGCAACCACTATCTCACGCTGGTCCTTCGTCGTCT
CACAGCGGTTCCAACACTTTCTTGACAAAACGGTCCCCTACATCCTCTACCGTTGGATCGCATGCTTAATCGTGGTCTTGATCTATGTAATCCGCGTCTA
CCTTGTTCAAGGTTTCTACATAATCACTTACGGTCTTGGTATTTACTTGCTTAATCTCTTGATTGGATTCTTGTCTCCCCAAATTGACCCCGAGATCCAT
GACGGGCCCTCTCTTCCTACTCGTGGATCAGACGAGTTTCGCCCCTTCGTCCGCCGGTTACTGGAATTCAAGTTCTGGTATTCGATTACCAAGGCGTTTT
GTATTGCCTTTGTAATGACATTTTTCAGTGTGTTTGATGTGCCTGTGTTCTGGCCTATATTACTTACCTACTGGGTCGTGCTTTTCGTTCTTACTATGAG
GAGACAGATTTCGCATATGATCAAGTATAGATATGTCCCATTCTCTACCGGTAAACAGCGATATGATGGAAAGAAGGCACCTTCGACTGACAGTGCATTA
TGA
AA sequence
>Potri.007G047800.1 pacid=42766219 polypeptide=Potri.007G047800.1.p locus=Potri.007G047800 ID=Potri.007G047800.1.v4.1 annot-version=v4.1
MEAGQPSGTLSVDDLSSLSSTPATTISRWSFVVSQRFQHFLDKTVPYILYRWIACLIVVLIYVIRVYLVQGFYIITYGLGIYLLNLLIGFLSPQIDPEIH
DGPSLPTRGSDEFRPFVRRLLEFKFWYSITKAFCIAFVMTFFSVFDVPVFWPILLTYWVVLFVLTMRRQISHMIKYRYVPFSTGKQRYDGKKAPSTDSAL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G39220 ATRER1A Rer1 family protein (.1) Potri.007G047800 0 1
AT4G25030 unknown protein Potri.010G219900 1.41 0.8100
AT1G18580 GAUT11 galacturonosyltransferase 11 (... Potri.015G060800 7.48 0.6544
AT4G12340 copper ion binding (.1) Potri.003G114200 9.32 0.6021
AT4G02350 SEC15B exocyst complex component sec1... Potri.014G127400 10.19 0.6558
AT3G60820 PBF1 N-terminal nucleophile aminohy... Potri.002G148300 10.95 0.7119 Pt-PBF1.1
AT3G20920 translocation protein-related ... Potri.009G052800 12.84 0.6812
AT1G50370 AtFYPP1 flower- specific, phytochrome-... Potri.008G003200 14.45 0.6963 ATFYPP3.2
AT2G01720 Ribophorin I (.1) Potri.010G223500 15.96 0.7177
AT5G65650 Protein of unknown function (D... Potri.007G027700 16.30 0.6400
AT3G12160 AtRABA4d ARABIDOPSIS THALIANA RAB GTPAS... Potri.001G270100 20.19 0.6601 RAB11.15

Potri.007G047800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.