Plant FIBer expression Database

Potri.007G049700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G143100
[exp]
112 / 4e-34 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.007G049700.1 pacid=42765297 polypeptide=Potri.007G049700.1.p locus=Potri.007G049700 ID=Potri.007G049700.1.v4.1 annot-version=v4.1
ATGAGACACTTCTGTTTAGTGCTGTTCATCTTGGCCATGATCCTACTTGTTACAAACCCATGTCTTGTCAATTGTAGAGCCCTTCGATCAGGAACACAGA
ACGAAATCAATGATCACCATGAAGCCACTGATACTGATGATCATGGGCCTGGTTCTGTGTCGACCAATATGAAAGCTTCGGTTCATTCAGAGCCTGTCAA
GGACGACGGTGGTGGTCGGGTTTCAGCAACTGACCGGCAGGTGTATAAGCCGACTTCCTCTGGACCTAGCGGGGAAGGCCCCGGGCACTAA
AA sequence
>Potri.007G049700.1 pacid=42765297 polypeptide=Potri.007G049700.1.p locus=Potri.007G049700 ID=Potri.007G049700.1.v4.1 annot-version=v4.1
MRHFCLVLFILAMILLVTNPCLVNCRALRSGTQNEINDHHEATDTDDHGPGSVSTNMKASVHSEPVKDDGGGRVSATDRQVYKPTSSGPSGEGPGH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G049700
[exp]
0 1
AT5G16530 PIN5 PIN-FORMED 5, Auxin efflux car... Potri.013G087000
[exp]
1.00 0.8978 PIN9.2
AT1G59970 Matrixin family protein (.1) Potri.008G027900
[exp]
6.48 0.8511
AT2G23260 UGT84B1 UDP-glucosyl transferase 84B1 ... Potri.007G049600
[exp]
6.70 0.8588
AT4G38380 MATE efflux family protein (.1... Potri.009G143400
[exp]
8.66 0.8160
AT3G45780 RPT1, NPH1, JK2... ROOT PHOTOTROPISM 1, NONPHOTOT... Potri.001G342000
[exp]
9.74 0.8512 Pt-PHOT1.1
AT1G59970 Matrixin family protein (.1) Potri.008G027600
[exp]
9.89 0.8270
AT1G10155 ATPP2-A10 phloem protein 2-A10 (.1) Potri.012G120280
[exp]
10.24 0.8458
AT5G54130 Calcium-binding endonuclease/e... Potri.015G004200
[exp]
10.39 0.8227
AT1G55090 carbon-nitrogen hydrolase fami... Potri.001G087400
[exp]
11.22 0.8215
AT4G19840 AtPP2A-1, ATPP2... phloem protein 2-A1 (.1) Potri.012G120400
[exp]
15.96 0.8258

Potri.007G049700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.