Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G24204 81 / 6e-20 RING/U-box superfamily protein (.1.2.3) AT2G38185 59 / 2e-10 RING/U-box superfamily protein (.1.2.3.4) AT2G38195 57 / 5e-10 RING/U-box superfamily protein (.1.2) AT2G38220 56 / 2e-09 RING/U-box superfamily protein (.1) AT5G01450 51 / 8e-08 RING/U-box superfamily protein (.1) AT3G23280 47 / 2e-06 XBAT35 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) AT4G14365 47 / 2e-06 XBAT34 XB3 ortholog 4 in Arabidopsis thaliana (.1) AT1G54150 46 / 4e-06 E3 Ubiquitin ligase family protein (.1) AT1G63900 45 / 1e-05 DAL1 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2) AT5G19080 43 / 4e-05 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G020900 [exp] 111 / 2e-29 AT5G01450 116 / 9e-29 RING/U-box superfamily protein (.1) Potri.001G251900 [exp] 74 / 1e-15 AT5G01450 327 / 7e-108 RING/U-box superfamily protein (.1) Potri.016G116300 [exp] 69 / 5e-14 AT5G01450 348 / 3e-116 RING/U-box superfamily protein (.1) Potri.006G100400 [exp] 65 / 2e-12 AT2G38185 341 / 2e-113 RING/U-box superfamily protein (.1.2.3.4) Potri.001G168700 [exp] 51 / 7e-08 AT1G54150 301 / 1e-99 E3 Ubiquitin ligase family protein (.1) Potri.003G065500 [exp] 49 / 4e-07 AT1G54150 341 / 3e-115 E3 Ubiquitin ligase family protein (.1) Potri.014G138000 [exp] 47 / 1e-06 AT1G63900 548 / 0.0 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2) Potri.005G225300 [exp] 46 / 4e-06 AT3G23280 355 / 2e-118 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Potri.018G011300 [exp] 44 / 1e-05 AT3G23280 105 / 6e-26 XB3 ortholog 5 in Arabidopsis thaliana (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010392 [exp] 96 / 5e-25 AT4G24204 86 / 7e-22 RING/U-box superfamily protein (.1.2.3) Lus10002487 [exp] 68 / 2e-13 AT5G01450 347 / 5e-115 RING/U-box superfamily protein (.1) Lus10004813 [exp] 64 / 3e-12 AT2G38185 309 / 2e-100 RING/U-box superfamily protein (.1.2.3.4) Lus10000533 [exp] 50 / 2e-07 AT1G54150 349 / 5e-119 E3 Ubiquitin ligase family protein (.1) Lus10009674 [exp] 46 / 4e-06 AT3G23280 499 / 6e-175 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Lus10003551 [exp] 46 / 5e-06 AT3G23280 115 / 5e-30 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Lus10009035 [exp] 46 / 5e-06 AT3G23280 524 / 0.0 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Lus10008163 [exp] 44 / 4e-05 AT1G63900 533 / 0.0 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2) Lus10027994 [exp] 43 / 4e-05 AT1G63900 532 / 0.0 DIAP1-like protein 1, E3 Ubiquitin ligase family protein (.1.2) Lus10034030 [exp] 42 / 0.0001 AT5G19080 344 / 1e-116 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13920 [poplar] [flax] zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Potri.007G050500.1 pacid=42765585 polypeptide=Potri.007G050500.1.p locus=Potri.007G050500 ID=Potri.007G050500.1.v4.1 annot-version=v4.1 ATGTACTCCATGGCAGACCTTGCAAAATCCCATTCTGTTAATTTAGCCACAAGAATTAACCTAACATGGACTAAAATAGGTCATTCGCTTGGTTGTTACC CGGCGATTTCTCTCTTGGCTCGTTTAGTTGCGTATGTTTCAATTTTAGCGTTTATCTTGATTTTTGTTCTCATAATTGTGAGATATATGACTTATTCTGA AGAGGGGAATGAAGTTGAAATAAGAGCAACGGAGACTGACCAACTATTGCCAAGCAAAGCACTGTCCTTATTATTCTCATACGGGACATGTAACAAAGAT TTAGAATCAGGAAATTGCAGTAGCAGCAGCAGCGACGGCAAGAACGGTTCTTCGGAGGAATTATATGATGGAAAAATATGTGTAATATGCTACGATGAGG AACGGAATTGTTTCTATGTTCCTTGTGGCCACTGTGCTACCTGCTATGTCTGTGCTCAGAGGATTTTTAACAGCGAAAACAAGGTCTGCCCCGTGTGCCG GAGATTTATTGGCAAAATAAGGAAACTTTTTGCCCCTTGA
AA sequence Show only first row Show all	>Potri.007G050500.1 pacid=42765585 polypeptide=Potri.007G050500.1.p locus=Potri.007G050500 ID=Potri.007G050500.1.v4.1 annot-version=v4.1 MYSMADLAKSHSVNLATRINLTWTKIGHSLGCYPAISLLARLVAYVSILAFILIFVLIIVRYMTYSEEGNEVEIRATETDQLLPSKALSLLFSYGTCNKD LESGNCSSSSSDGKNGSSEELYDGKICVICYDEERNCFYVPCGHCATCYVCAQRIFNSENKVCPVCRRFIGKIRKLFAP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G24204			RING/U-box superfamily protein...		Potri.007G050500 [exp]	0	1
AT4G02370			Protein of unknown function, D...		Potri.014G127500 [exp]	1.00	0.9260
AT1G17260		AHA10	autoinhibited H\(+\)-ATPase is...		Potri.001G161400 [exp]	1.41	0.9149	AHA10.1
AT3G55120		A11, CFI, TT5	TRANSPARENT TESTA 5, CHALCONE ...		Potri.010G213000 [exp]	1.73	0.9074	CHI.1
AT2G47115			unknown protein		Potri.014G115200 [exp]	3.46	0.8971
AT2G36290			alpha/beta-Hydrolases superfam...		Potri.008G021000 [exp]	4.24	0.8715
AT5G05270			Chalcone-flavanone isomerase f...		Potri.019G057800 [exp]	6.63	0.8686
AT5G48810		B5#3, ATB5-B, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Potri.014G019200 [exp]	6.70	0.8776
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Potri.003G176800 [exp]	8.12	0.8746	CHS.5
AT3G62760		ATGSTF13	Glutathione S-transferase fami...		Potri.002G207672 [exp]	9.48	0.8405
AT1G09850		XBCP3	xylem bark cysteine peptidase ...		Potri.004G057700 [exp]	10.00	0.8686

Compare expression of checked genes

Potri.007G050500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.