Potri.007G051300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G14900 61 / 3e-13 Gibberellin-regulated family protein (.1)
AT2G39540 59 / 6e-13 Gibberellin-regulated family protein (.1)
AT5G59845 59 / 1e-12 Gibberellin-regulated family protein (.1)
AT1G10588 55 / 3e-11 Gibberellin-regulated family protein (.1.2)
AT3G10185 42 / 4e-06 Gibberellin-regulated family protein (.1)
AT2G30810 41 / 1e-05 Gibberellin-regulated family protein (.1)
AT1G74670 39 / 5e-05 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT3G02885 39 / 9e-05 GASA5 GAST1 protein homolog 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G020100 65 / 4e-15 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1)
Potri.009G092600 64 / 2e-14 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.001G297700 63 / 2e-14 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1)
Potri.001G315500 44 / 6e-07 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1)
Potri.006G044400 43 / 3e-06 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Potri.001G254100 42 / 5e-06 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Potri.017G083000 40 / 2e-05 AT5G15230 116 / 3e-35 GAST1 protein homolog 4 (.1.2)
Potri.017G124200 40 / 2e-05 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1)
Potri.013G113400 39 / 4e-05 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024791 63 / 3e-14 AT5G59845 114 / 5e-35 Gibberellin-regulated family protein (.1)
Lus10018708 62 / 7e-14 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1)
Lus10001407 61 / 2e-13 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1)
Lus10004048 40 / 4e-05 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10018016 40 / 6e-05 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10029340 39 / 7e-05 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1)
Lus10042012 39 / 0.0001 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10030680 38 / 0.0002 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2)
Lus10024216 37 / 0.0006 AT1G74670 106 / 1e-30 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10002059 37 / 0.0006 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Potri.007G051300.1 pacid=42765146 polypeptide=Potri.007G051300.1.p locus=Potri.007G051300 ID=Potri.007G051300.1.v4.1 annot-version=v4.1
ATGAAGCTCTCTTTTGCAGCACTGCTGCTACTTTCAGTGGTCCTCCTGTCCTCTTTCCTTCGGTTCACCATGGCTGTGCCCAACCACGTCGCGTCACCTC
CACCTCCCTCCCCAGCAATTCCAAGTTTCTGTGATCCAAAGTGCAAGGCTAGGTGTGCCAAGGCGGGATACTACCAACGCTGCTATGACTACTGTATAAT
CTGCTGCAAAGATTGCAAGTGTGTGCCTTCAGGGACTTACGGAAACAAGTCAGAATGTCCATGCTACAGAGACAAGTTGAACTCAAAGGGCACCTCCAAA
TGCCCTTAA
AA sequence
>Potri.007G051300.1 pacid=42765146 polypeptide=Potri.007G051300.1.p locus=Potri.007G051300 ID=Potri.007G051300.1.v4.1 annot-version=v4.1
MKLSFAALLLLSVVLLSSFLRFTMAVPNHVASPPPPSPAIPSFCDPKCKARCAKAGYYQRCYDYCIICCKDCKCVPSGTYGNKSECPCYRDKLNSKGTSK
CP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G14900 Gibberellin-regulated family p... Potri.007G051300 0 1
AT5G50400 ATPAP27, PAP27 ARABIDOPSIS THALIANA PURPLE AC... Potri.001G023400 5.65 0.9187
Potri.019G016110 9.05 0.9351
AT2G45360 Protein of unknown function (D... Potri.014G068900 9.32 0.9347
AT3G12830 SAUR-like auxin-responsive pro... Potri.003G070900 9.79 0.9087 SAUR14
AT3G22800 Leucine-rich repeat (LRR) fami... Potri.010G083000 10.48 0.9323
Potri.012G124832 12.00 0.9168
AT1G54830 CCAAT NF-YC3 "nuclear factor Y, subunit C3"... Potri.001G106900 12.72 0.9002
AT5G10530 Concanavalin A-like lectin pro... Potri.001G283866 13.41 0.9156
AT3G60530 GATA GATA4 GATA transcription factor 4 (.... Potri.014G058600 13.67 0.9154
AT4G13830 J20 DNAJ-like 20 (.1.2) Potri.007G088900 14.28 0.9077

Potri.007G051300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.