Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G23096 300 / 4e-102 P4H13 prolyl 4-hydroxylase 13, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G66060 187 / 8e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G20270 185 / 5e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G17720 174 / 1e-52 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G28490 174 / 1e-52 Oxoglutarate/iron-dependent oxygenase (.1) AT3G28480 172 / 2e-51 Oxoglutarate/iron-dependent oxygenase (.1.2) AT4G35810 170 / 4e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G18900 168 / 3e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G06300 164 / 1e-48 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G296800 [exp] 369 / 3e-129 AT4G33910 441 / 6e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G091000 [exp] 354 / 2e-123 AT4G33910 431 / 9e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G075300 [exp] 188 / 1e-58 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.005G245300 [exp] 185 / 5e-57 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G108000 [exp] 179 / 2e-54 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.008G197700 [exp] 177 / 1e-53 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G075100 [exp] 177 / 2e-53 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.007G060800 [exp] 174 / 1e-52 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.002G232100 [exp] 162 / 6e-48 AT2G43080 456 / 4e-164 P4H isoform 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011085 [exp] 246 / 1e-80 AT4G33910 241 / 4e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10028404 [exp] 184 / 1e-56 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041857 [exp] 182 / 1e-55 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10032183 [exp] 181 / 3e-55 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10016271 [exp] 172 / 7e-52 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10012014 [exp] 171 / 2e-51 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014502 [exp] 170 / 7e-51 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10031048 [exp] 162 / 1e-48 AT2G43080 406 / 7e-145 P4H isoform 1 (.1) Lus10005620 [exp] 155 / 5e-45 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10017249 [exp] 141 / 3e-39 AT1G20270 455 / 3e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF13640 [poplar] [flax] 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Potri.007G052600.1 pacid=42766459 polypeptide=Potri.007G052600.1.p locus=Potri.007G052600 ID=Potri.007G052600.1.v4.1 annot-version=v4.1 ATGAGAGGCAAAGCTTGTAAAGAAAACTGGAGGTTTTATAAGAAACCAAACTTAGGCTTCCCTGCTCTGATTCTCTCATGCTCATTTTTCTTTATTGCCG GCCTGTTTGCCTCAAATCTTCTTCTCTCTCAGGGTACATCAAGTGATGAAAGGTGGCTGAGGGCAAGAGCAAGGCAACTCCAATCAGTGGAGGAAGAGAT TATTAGCAAGTATGATCTATTACCAAGTGGAGAGAGTGGAGATGATTTTATTACCCTTATCCCGTTTCAGGTTTTAAGCTGGCGGCCGCGAGCGCTATAT TATCCAGGTTTTATAACCGCAGAGCAGTGTCAGCACATAATTAATATGGCAAAGCCAAGCCTTCAGCCTTCAACTTTGGCTTTACGGAAGGGAGAAACTG CAGAAACCACAAAAGGAATCAGAACAAGCTCTGGCATGTTTGTTTTTTCTTCCGAAGACCAAGCTGGAGTCTTACAAGTCATCGAGGAAAAAATTGCTCG GGCCACCATGATTCCAAGTACTCATGGAGAGGCTTTCAATGTCCTGCGCTATGAGATTGGCCAAAAGTATGATGCTCATTACGATGCGTTCAATCCTGCA GAATACGGGCCTCAAACGAGCCAAAGGGTGGCCACATTCTTGCTGTATCTATCTAATTTTGAAGAAGGCGGGGAGACCACATTTCCGATTGAGAATGATG AAAACTTTGAAGGATATGATGCCCAGAAATGCAACGGTTTAAGGGTAAAACCACATCAAGGGGATGCAATTCTGTTCTACTCAATATTCCCTAACAATAC AATTGACCCGGCATCTCTTCATGCAAGCTGTCATGTAATCAAAGGGGAGAAATGGGTGGCTACTAAGTGGATTAGAGATCAAGTACAAGTTTAA
AA sequence Show only first row Show all	>Potri.007G052600.1 pacid=42766459 polypeptide=Potri.007G052600.1.p locus=Potri.007G052600 ID=Potri.007G052600.1.v4.1 annot-version=v4.1 MRGKACKENWRFYKKPNLGFPALILSCSFFFIAGLFASNLLLSQGTSSDERWLRARARQLQSVEEEIISKYDLLPSGESGDDFITLIPFQVLSWRPRALY YPGFITAEQCQHIINMAKPSLQPSTLALRKGETAETTKGIRTSSGMFVFSSEDQAGVLQVIEEKIARATMIPSTHGEAFNVLRYEIGQKYDAHYDAFNPA EYGPQTSQRVATFLLYLSNFEEGGETTFPIENDENFEGYDAQKCNGLRVKPHQGDAILFYSIFPNNTIDPASLHASCHVIKGEKWVATKWIRDQVQV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G33910			2-oxoglutarate (2OG) and Fe(II...		Potri.007G052600 [exp]	0	1
					Potri.010G206700 [exp]	1.00	0.9232
AT1G46480	HD	WOX4	WUSCHEL related homeobox 4 (.1...		Potri.014G025300 [exp]	4.00	0.9222
AT2G34770		ATFAH1, FAH1	ARABIDOPSIS FATTY ACID HYDROXY...		Potri.011G162000 [exp]	6.70	0.9212	Pt-FAH1.1
AT3G59540			Ribosomal L38e protein family ...		Potri.010G181200 [exp]	6.92	0.9163	Pt-RPL38.2
AT5G55190		RAN3, ATRAN3	RAN GTPase 3 (.1)		Potri.006G250300 [exp]	7.07	0.9085	Pt-RAN1.2
AT2G46225		ABIL1, ABI1L1	ABI-1-like 1 (.1.2.3)		Potri.018G082600 [exp]	9.05	0.8816
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Potri.006G121700 [exp]	11.31	0.9000	Pt-TIP2.7
AT1G11680		EMB1738, CYP51A...	embryo defective 1738, CYTOCHR...		Potri.001G068400 [exp]	11.83	0.9109	CYP51.2
AT3G17365			S-adenosyl-L-methionine-depend...		Potri.010G153200 [exp]	12.24	0.8925
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Potri.014G094800 [exp]	13.03	0.9164	AGP20.1

Compare expression of checked genes

Potri.007G052600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.