Potri.007G053400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G67400 471 / 3e-168 RHS19 root hair specific 19 (.1)
AT4G37530 469 / 1e-167 Peroxidase superfamily protein (.1.2)
AT4G37520 462 / 7e-165 Peroxidase superfamily protein (.1.2)
AT3G49960 444 / 1e-157 Peroxidase superfamily protein (.1)
AT2G18980 431 / 1e-152 Peroxidase superfamily protein (.1)
AT4G30170 424 / 1e-149 Peroxidase family protein (.1)
AT5G14130 345 / 2e-118 Peroxidase superfamily protein (.1)
AT4G17690 282 / 7e-94 Peroxidase superfamily protein (.1)
AT5G47000 274 / 1e-90 Peroxidase superfamily protein (.1)
AT2G34060 272 / 1e-89 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G089900 444 / 1e-157 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Potri.001G329200 397 / 2e-139 AT4G37530 392 / 4e-137 Peroxidase superfamily protein (.1.2)
Potri.017G064100 396 / 8e-139 AT5G67400 372 / 2e-129 root hair specific 19 (.1)
Potri.007G074700 302 / 1e-101 AT5G47000 358 / 8e-124 Peroxidase superfamily protein (.1)
Potri.012G076500 284 / 1e-94 AT4G17690 423 / 1e-149 Peroxidase superfamily protein (.1)
Potri.010G036100 271 / 1e-89 AT1G24110 400 / 2e-140 Peroxidase superfamily protein (.1)
Potri.004G052100 265 / 6e-87 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1)
Potri.001G351000 260 / 2e-85 AT3G28200 448 / 2e-159 Peroxidase superfamily protein (.1)
Potri.002G018000 258 / 2e-84 AT5G42180 483 / 1e-173 peroxidase 64, Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011079 518 / 0 AT4G37530 479 / 2e-171 Peroxidase superfamily protein (.1.2)
Lus10001442 413 / 4e-145 AT4G30170 475 / 7e-170 Peroxidase family protein (.1)
Lus10012540 370 / 4e-128 AT5G14130 384 / 5e-134 Peroxidase superfamily protein (.1)
Lus10032035 361 / 5e-125 AT5G67400 394 / 3e-138 root hair specific 19 (.1)
Lus10010716 285 / 6e-95 AT1G24110 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10039445 277 / 6e-92 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10001622 273 / 4e-90 AT2G18980 320 / 4e-109 Peroxidase superfamily protein (.1)
Lus10042144 268 / 2e-88 AT1G24110 390 / 2e-136 Peroxidase superfamily protein (.1)
Lus10004234 267 / 6e-88 AT1G24110 391 / 1e-136 Peroxidase superfamily protein (.1)
Lus10035204 265 / 1e-87 AT5G67400 270 / 5e-90 root hair specific 19 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.007G053400.1 pacid=42765392 polypeptide=Potri.007G053400.1.p locus=Potri.007G053400 ID=Potri.007G053400.1.v4.1 annot-version=v4.1
ATGGCAGCTGCCCGGTTCCATCTCTTACTTGTTCTTTCACTCACTCTCAGTTTGTGCCACTTCCCTGACACCACATGGGCGCAGCTTAGGCAAAATTACT
ACGCTAGCAGTTGCCCCAGAGTGGAAAGCATAGTTAGGGGTGTCGTTCAGAATAAAATTAAACAAACCTTTGTTACGATTCCGGCAACTCTCAGGCTTTT
CTTCCATGATTGCTTTGTTCAGGGCTGTGATGCTTCAGTTATAGTGGCCTCCACTGCAACCAACAAGGCGGAGAAGGACCATTCTGATAATTTATCATTA
GCTGGAGATGGATTTGACACTGTGATCAAAGCGAAAGCGGCTGTTGATGCCACCCCCGGATGCAAAAACAAGGTCTCGTGTGCTGATATCCTTGCCATAG
CAACAAGAGATGTTATCGCACTGTCTGGTGGGCCTTCATATCCTGTTGAATTGGGACGATTGGATGGTTTAAGCTCAACAGCTGCTAGTGTCAATGGGAA
GCTGCCTCAGCCAACTTTCTCTTTGAATCAGCTTACTGCTATGTTTGCTGCCAACGGACTCAGCCAAACTGACATGATTGCTCTCTCAGCGGCACACACG
CTTGGATTCTCTCATTGTAGCAAATTTGCCAACAGGATATATAGTTTTAGCAGGCAAGGTCCGATCGACCCTACACTCAACCGAACATATGCAAAAACAC
TGCAAACTCTGTGCCCCAAAAACGTTGACTCCAGAATAGCCATCAACATGGACCCAAACACTCCCAACACCTTTGACAACATGTATTACAAGAACCTCGT
GCAAGGAATGGGCCTCTTCACCTCTGATCAAGTTCTATTCACAGACTCAAGGTCCAAGCCAACTGTTACTAAATGGGCTACTGACTCACAGGCCTTTCAA
CAAGCCTTTATCACTGCCATGACAAAGTTGGGCCGCGTCGGTGTCAAGAGCGGTCGAAATGGGAAAATTCGTCAAGACTGCGCAGTTTTGGCTTAA
AA sequence
>Potri.007G053400.1 pacid=42765392 polypeptide=Potri.007G053400.1.p locus=Potri.007G053400 ID=Potri.007G053400.1.v4.1 annot-version=v4.1
MAAARFHLLLVLSLTLSLCHFPDTTWAQLRQNYYASSCPRVESIVRGVVQNKIKQTFVTIPATLRLFFHDCFVQGCDASVIVASTATNKAEKDHSDNLSL
AGDGFDTVIKAKAAVDATPGCKNKVSCADILAIATRDVIALSGGPSYPVELGRLDGLSSTAASVNGKLPQPTFSLNQLTAMFAANGLSQTDMIALSAAHT
LGFSHCSKFANRIYSFSRQGPIDPTLNRTYAKTLQTLCPKNVDSRIAINMDPNTPNTFDNMYYKNLVQGMGLFTSDQVLFTDSRSKPTVTKWATDSQAFQ
QAFITAMTKLGRVGVKSGRNGKIRQDCAVLA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G67400 RHS19 root hair specific 19 (.1) Potri.007G053400 0 1
Potri.008G036000 1.41 0.8922
AT4G39710 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex... Potri.007G087401 4.24 0.8662
AT4G16380 Heavy metal transport/detoxifi... Potri.006G019800 5.19 0.8622
AT2G29380 HAI3 highly ABA-induced PP2C gene 3... Potri.001G245200 8.94 0.8433
AT2G40610 ATHEXPALPHA1.11... expansin A8 (.1) Potri.016G135200 13.74 0.8247 PtEXPA13,EXP2.9
AT1G52140 unknown protein Potri.018G046500 16.06 0.8366
AT3G27250 unknown protein Potri.001G334500 16.61 0.8052
Potri.001G076600 18.54 0.8457
AT1G25480 Aluminium activated malate tra... Potri.008G118600 19.44 0.7877
AT4G16380 Heavy metal transport/detoxifi... Potri.006G020300 22.24 0.7765

Potri.007G053400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.