Potri.007G057300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17450 66 / 1e-13 RHA3A RING-H2 finger A3A (.1)
AT1G53820 66 / 3e-13 RING/U-box superfamily protein (.1)
AT5G05280 64 / 5e-13 RING/U-box superfamily protein (.1)
AT3G10910 64 / 8e-13 RING/U-box superfamily protein (.1)
AT2G27940 64 / 1e-12 RING/U-box superfamily protein (.1)
AT4G35480 63 / 1e-12 RHA3B RING-H2 finger A3B (.1)
AT5G17600 64 / 2e-12 RING/U-box superfamily protein (.1)
AT5G47610 62 / 2e-12 RING/U-box superfamily protein (.1)
AT4G09100 61 / 2e-12 RING/U-box superfamily protein (.1)
AT1G35330 64 / 3e-12 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G113200 190 / 6e-62 AT2G17450 66 / 2e-13 RING-H2 finger A3A (.1)
Potri.003G073300 68 / 5e-14 AT1G53820 157 / 2e-46 RING/U-box superfamily protein (.1)
Potri.007G086300 66 / 8e-14 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.005G081200 66 / 1e-13 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1)
Potri.001G159300 65 / 1e-13 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1)
Potri.001G162000 67 / 2e-13 AT1G53820 149 / 2e-43 RING/U-box superfamily protein (.1)
Potri.001G309700 66 / 2e-13 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1)
Potri.007G086100 64 / 3e-13 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1)
Potri.003G075200 64 / 3e-13 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028454 72 / 1e-15 AT1G72200 85 / 3e-19 RING/U-box superfamily protein (.1)
Lus10041907 71 / 1e-14 AT4G36050 410 / 6e-135 endonuclease/exonuclease/phosphatase family protein (.1.2)
Lus10033425 68 / 3e-14 AT3G10910 82 / 6e-20 RING/U-box superfamily protein (.1)
Lus10022743 65 / 4e-13 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1)
Lus10029037 64 / 4e-13 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1)
Lus10027736 64 / 6e-13 AT4G17905 89 / 8e-22 RING/U-box superfamily protein (.1)
Lus10022223 65 / 7e-13 AT1G23980 81 / 2e-17 RING/U-box superfamily protein (.1)
Lus10020859 65 / 1e-12 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1)
Lus10008797 64 / 1e-12 AT5G40250 77 / 2e-16 RING/U-box superfamily protein (.1)
Lus10033515 64 / 2e-12 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.007G057300.1 pacid=42765781 polypeptide=Potri.007G057300.1.p locus=Potri.007G057300 ID=Potri.007G057300.1.v4.1 annot-version=v4.1
ATGGATCAAATTCACCGTTTTAGTAGACATCTGTTGAATGCTAATTTGCCAAGACAGGAGGAAAGAGCAGATGAAGGAGGATCATTTGTGGGTATTGGCA
TAGCTTATGGTGTCATATTTGCTCTTGTCATCCTCTTTTTTGTTTCCAGATGCAAGTGTTCTATTAGTTCAAGAAACTTGTCTTCCAATAATCAGCAAAG
TCCTACAACATCCAGCTCATGTTCCCATGAACCTAATACACAAACCCACCAGGAACTTGTAGCCCTACCGATTTTTGTCTTTGGAGAACAGACACCACCC
TCAATCTCAAGCATAGCGTTGCCGCAATTATCATCATCAGAATCTTCTTCTTCATTCGTATTTCCTGATGGAGACTGTGCGATTTGCTTGGATGATTATG
TTCATGGGGAGTCCATCAGGGTCTTGCCTAGGTGTAAGCACATGTTCCATAAGGACTGTATTGATCACTGGCTATCATCAAGAACTTCAAGCTGTCCCAT
TTGTAGAGCCAAATCATAG
AA sequence
>Potri.007G057300.1 pacid=42765781 polypeptide=Potri.007G057300.1.p locus=Potri.007G057300 ID=Potri.007G057300.1.v4.1 annot-version=v4.1
MDQIHRFSRHLLNANLPRQEERADEGGSFVGIGIAYGVIFALVILFFVSRCKCSISSRNLSSNNQQSPTTSSSCSHEPNTQTHQELVALPIFVFGEQTPP
SISSIALPQLSSSESSSSFVFPDGDCAICLDDYVHGESIRVLPRCKHMFHKDCIDHWLSSRTSSCPICRAKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G17450 RHA3A RING-H2 finger A3A (.1) Potri.007G057300 0 1
AT1G48050 KU80, ATKU80 ARABIDOPSIS THALIANA KU80 HOMO... Potri.002G148200 4.24 0.8062
AT2G37680 PAT3, FRY1, FHY... unknown protein Potri.016G100600 5.74 0.6910 FHY1.2
AT5G18260 RING/U-box superfamily protein... Potri.006G180600 9.48 0.7442
AT5G08290 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, m... Potri.007G072700 13.22 0.7423
Potri.008G105401 15.62 0.7612
AT4G14615 unknown protein Potri.008G160101 24.16 0.7412
AT1G65780 P-loop containing nucleoside t... Potri.004G077800 25.21 0.7299
AT5G13960 SDG33, KYP, SUV... SET DOMAIN PROTEIN 33, KRYPTON... Potri.003G162801 27.82 0.7077
AT5G10830 S-adenosyl-L-methionine-depend... Potri.005G067500 31.46 0.7337
AT3G47570 Leucine-rich repeat protein ki... Potri.011G141001 32.01 0.6990

Potri.007G057300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.