Potri.007G059800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35730 398 / 4e-135 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G34220 256 / 4e-78 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G25420 225 / 1e-69 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT2G19710 210 / 3e-59 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 205 / 3e-57 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G13340 129 / 7e-33 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT2G14830 128 / 3e-32 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G79910 127 / 4e-32 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G52315 119 / 1e-29 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G32350 115 / 6e-27 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G117100 251 / 1e-76 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.019G087400 249 / 5e-76 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.008G121300 241 / 8e-76 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.006G149800 244 / 8e-71 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.010G127000 148 / 2e-39 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.017G113900 137 / 5e-37 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.013G135700 140 / 1e-35 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.004G100900 137 / 9e-35 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.001G181300 132 / 6e-33 AT1G79910 244 / 1e-75 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041836 456 / 8e-158 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028383 439 / 5e-151 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028724 261 / 1e-81 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10006061 259 / 2e-80 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10000978 238 / 2e-68 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10040542 236 / 5e-68 AT2G19710 309 / 2e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041442 198 / 5e-60 AT1G25420 270 / 6e-90 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Lus10041468 161 / 4e-44 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10034330 155 / 3e-43 AT1G25420 218 / 3e-69 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Lus10034303 152 / 1e-40 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Potri.007G059800.2 pacid=42765726 polypeptide=Potri.007G059801.1.p locus=Potri.007G059800 ID=Potri.007G059800.2.v4.1 annot-version=v4.1
ATGACTGCTAGCAGTGTAGTCACTTCTCACACCAAGAAATTCATGAAGCTCACTATCTCAATCTTTTGTCCACGCTTCAACTCTTCAAAATGTAAAACAG
CGGCTAAAATGGCAGTGGCCAGGATAAAGTTGTTGAGGAATAAGAGAGAGGCAGTGATGAGGCAAATGAGGAGAGACATCGCCTTGCTTTTACAATCTGG
TCAAGATGCTACTGCTCGTATCCGGGTTGAGCATGTTATAAGAGAGCAGAATGTTTTGGCTGCAAATGAGTTCATTGAGCTCTTCTGTGAGTTGGTTGTT
TCTAGACTTTCAATCATTGCAAAGCGAAGGGAATGCCCAGCTGACCTGAAAGAAGGGATTGCTAGTTTAATATTTGCATCTCCAAGGTGCTCTGAAATTC
CAGAATTGGTAGCACTCAGGAAGATTTTTGAGAAGAAGTATGGGAAGGATTTTGTGTCCGCAGCTACTGATCTGCGACCTAACAGTGGTGTAAATCGCAT
GTTAATCGACAAGCTTTCTGTTAGAACTCCAACTGGTGAAGTGAAGCTGAAAGTCATGAAGGAAATTGCCAAAGAACATCAGATTGAATGGGATACTGAA
GAATCTGAGAAGGAGCTTCTCAAGGCTCCAGAGGAGATGATTGAGGGACCACACACTTTTGTTAGTGCCTCCAGTTTACCCATAAGGAGAGCTCCATTCC
AATCTGTTGAGCCAAATCAACCAATTGCTAGGTCAACCAATGAGGGAGAAACGGGCAACATGCATTTTGAAGACACTGTGTCCGCTGCTCAAGCAGCAGC
AGAATCTGCGAAGCAAGCAATTGCAGCCGCCCAAGCTGCTGCTTATCTAGCCAACAATGGCTTGAATCAGGTCTCTTCAGTGTCTGGTTTGGATCACAAG
TTGAATACTTCTAACATCAATCATGGATTAGGAGTGCTTTCTGGCAATTCAACAGGCCTTTCCATGCCAAATCATTCCCAGATCAACTATCAGAGGATGG
ATCATTATTCTGATGGTCCAGGGAGAACGTATGAGTCCCAGAATTTTGATAGATCTCACTATCCAGGCAATGAAGGAACAAGACCAATCCAGACAGACAG
CAAACATGTCAATAGGAGGAGACACAGCTACAATGAGACGATGCCAAAGCAGATGGATGGTCAAAATGTCTCCCGGAGACACAGTTACAATGAGGTGAGG
CCAATGCAGATGGATGGTGAGAACATTTCCAGGAGACAGAGCTACAATTCTAGTTCTCCACATTCAGATATTAAGTTCGATGAATCAGACTGTGATGAAG
AGATTGAAACAGAAGAACCACCTGCTGGTGTTTGTCCACCACCTGAACGCTGTCCACCGCCAGTGCCTTCATCTCATGTTAATCTGGACCCTGTTGCCCG
AGTTCACCCGAAATTACCCGATTATGATGAACTTGCTGCCCGTTTTGAAGCTCTAAAATATCGCAAGTCATAA
AA sequence
>Potri.007G059800.2 pacid=42765726 polypeptide=Potri.007G059801.1.p locus=Potri.007G059800 ID=Potri.007G059800.2.v4.1 annot-version=v4.1
MTASSVVTSHTKKFMKLTISIFCPRFNSSKCKTAAKMAVARIKLLRNKREAVMRQMRRDIALLLQSGQDATARIRVEHVIREQNVLAANEFIELFCELVV
SRLSIIAKRRECPADLKEGIASLIFASPRCSEIPELVALRKIFEKKYGKDFVSAATDLRPNSGVNRMLIDKLSVRTPTGEVKLKVMKEIAKEHQIEWDTE
ESEKELLKAPEEMIEGPHTFVSASSLPIRRAPFQSVEPNQPIARSTNEGETGNMHFEDTVSAAQAAAESAKQAIAAAQAAAYLANNGLNQVSSVSGLDHK
LNTSNINHGLGVLSGNSTGLSMPNHSQINYQRMDHYSDGPGRTYESQNFDRSHYPGNEGTRPIQTDSKHVNRRRHSYNETMPKQMDGQNVSRRHSYNEVR
PMQMDGENISRRQSYNSSSPHSDIKFDESDCDEEIETEEPPAGVCPPPERCPPPVPSSHVNLDPVARVHPKLPDYDELAARFEALKYRKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G35730 Regulator of Vps4 activity in ... Potri.007G059800 0 1
AT3G20060 UBC19 ubiquitin-conjugating enzyme19... Potri.009G049600 4.47 0.9591 Pt-UBC19.1
AT1G04030 unknown protein Potri.002G258501 8.30 0.9559
AT1G31335 unknown protein Potri.003G148100 9.79 0.9511
AT4G08330 unknown protein Potri.005G070600 10.24 0.9513
AT5G16250 unknown protein Potri.008G078000 11.83 0.9537
AT1G20070 unknown protein Potri.005G241800 13.41 0.9288
AT3G20060 UBC19 ubiquitin-conjugating enzyme19... Potri.001G254500 14.66 0.9535 UBC19.2
AT4G02800 unknown protein Potri.005G209400 16.79 0.9522
AT3G52110 unknown protein Potri.001G267600 19.07 0.9363
AT5G16250 unknown protein Potri.010G179300 19.33 0.9442

Potri.007G059800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.