Plant FIBer expression Database

Potri.007G060500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G106300
[exp]
64 / 7e-14 AT3G51380 85 / 2e-22 IQ-domain 20 (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.007G060500.2 pacid=42765723 polypeptide=Potri.007G060500.2.p locus=Potri.007G060500 ID=Potri.007G060500.2.v4.1 annot-version=v4.1
ATGGCAAGAAAGGGCATCTCGGAACTGGTTAGACGAAGTTCGCAGAAACTTTCTCCGGTCATCTCATACAAACATCATTCTCAATTCCAATGCTTGCTCA
AGACCTTAATTAGCATAGCTTCACCACCTTCAAAGAGAGAACTCACCATAGAAGGTACAGCAGCAATCACAATTCAAGCAAATTTCAGGGGTCACCTTGT
ATCATGCAAGACGGGCATTTCAAGCACTCCAGAGCCTGGTGAAATTGCAAGCGTCAAGCGCTCGTCCGGTTGCAGGTACAGGTTTGAGCAAGGCAGGACA
TCTTCATATCTAAGGTCTAAACTCATATCACTATACAATTCAAGGAGAGTGCTCTAA
AA sequence
>Potri.007G060500.2 pacid=42765723 polypeptide=Potri.007G060500.2.p locus=Potri.007G060500 ID=Potri.007G060500.2.v4.1 annot-version=v4.1
MARKGISELVRRSSQKLSPVISYKHHSQFQCLLKTLISIASPPSKRELTIEGTAAITIQANFRGHLVSCKTGISSTPEPGEIASVKRSSGCRYRFEQGRT
SSYLRSKLISLYNSRRVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G060500
[exp]
0 1
AT4G16260 Glycosyl hydrolase superfamily... Potri.009G050300
[exp]
1.41 0.9313
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Potri.007G074466
[exp]
10.81 0.9067
AT2G31335 unknown protein Potri.010G075133
[exp]
15.90 0.9424
AT5G16340 AMP-dependent synthetase and l... Potri.019G068001
[exp]
17.23 0.9001
AT2G46620 P-loop containing nucleoside t... Potri.014G102300
[exp]
24.65 0.9217
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Potri.007G074400
[exp]
26.60 0.9269
AT4G08850 Leucine-rich repeat receptor-l... Potri.002G007925
[exp]
31.06 0.8814
AT2G35910 RING/U-box superfamily protein... Potri.008G018900
[exp]
38.53 0.8574
AT3G11840 PUB24 plant U-box 24 (.1) Potri.016G069500
[exp]
45.93 0.9060
AT1G61720 BAN BANYULS, NAD(P)-binding Rossma... Potri.011G031700
[exp]
216.93 0.8835 ANR/BAN2,Pt-BAN.1

Potri.007G060500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.