Potri.007G061400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17730 352 / 7e-124 NIP2 NEP-interacting protein 2 (.1.2)
AT4G35840 350 / 1e-123 RING/U-box superfamily protein (.1)
AT5G66070 337 / 1e-118 RING/U-box superfamily protein (.1.2)
AT1G74410 141 / 2e-41 RING/U-box superfamily protein (.1)
AT3G20395 111 / 8e-30 RING/U-box superfamily protein (.1)
AT2G17450 77 / 5e-17 RHA3A RING-H2 finger A3A (.1)
AT5G17600 78 / 2e-16 RING/U-box superfamily protein (.1)
AT3G18773 74 / 1e-15 RING/U-box superfamily protein (.1)
AT1G49200 74 / 1e-15 RING/U-box superfamily protein (.1)
AT3G03550 75 / 2e-15 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G108200 421 / 2e-151 AT4G35840 369 / 7e-131 RING/U-box superfamily protein (.1)
Potri.001G435800 157 / 1e-47 AT3G20395 153 / 4e-46 RING/U-box superfamily protein (.1)
Potri.005G244800 124 / 9e-35 AT4G35840 132 / 3e-38 RING/U-box superfamily protein (.1)
Potri.013G073500 84 / 2e-18 AT3G03550 262 / 2e-85 RING/U-box superfamily protein (.1)
Potri.019G043900 80 / 1e-17 AT3G03550 223 / 3e-71 RING/U-box superfamily protein (.1)
Potri.007G111900 81 / 2e-17 AT4G33565 163 / 1e-46 RING/U-box superfamily protein (.1)
Potri.017G049300 79 / 8e-17 AT4G33565 166 / 6e-48 RING/U-box superfamily protein (.1)
Potri.005G244900 74 / 2e-16 AT5G66070 79 / 1e-18 RING/U-box superfamily protein (.1.2)
Potri.019G010500 75 / 5e-16 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028406 392 / 5e-140 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10041859 392 / 5e-140 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10021524 150 / 2e-44 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1)
Lus10001654 132 / 1e-37 AT1G74410 251 / 1e-84 RING/U-box superfamily protein (.1)
Lus10021628 126 / 2e-35 AT1G74410 250 / 5e-84 RING/U-box superfamily protein (.1)
Lus10040073 81 / 1e-18 AT3G20395 94 / 5e-24 RING/U-box superfamily protein (.1)
Lus10013618 78 / 1e-16 AT5G17600 220 / 1e-69 RING/U-box superfamily protein (.1)
Lus10024405 74 / 3e-16 AT4G17905 95 / 9e-24 RING/U-box superfamily protein (.1)
Lus10025338 74 / 7e-16 AT4G17905 99 / 4e-25 RING/U-box superfamily protein (.1)
Lus10012745 76 / 1e-15 AT4G33565 168 / 4e-49 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.007G061400.3 pacid=42766767 polypeptide=Potri.007G061400.3.p locus=Potri.007G061400 ID=Potri.007G061400.3.v4.1 annot-version=v4.1
ATGGAGGTTTATCCATGCCCATCTCGTTTTTCTATGTCTTCATTGTCTTCTTTTGGGAATTTTGTTGAAAAGGTTAAAGAACTTTGTAACCTTGCTGTTT
CTGCTATCATTGGCAACATATTCTCTGCGATCTTCACCTTTTTCTTTGCATTAGTTTGGAAGTTTTTGTTAAAGGAATTGGCATTGTCGAATGCAGTGGG
CGCTTTGTTAGGAGCCATGACTGGGGCATTGATAGGCCAAGAAACTGAAAGCGGATTTGTTCGAGGGGCTGCAGTTGGAGCCATATCCGGAGCTGTTTTC
TCAATTGAAGTATTCGAGTCATCTCTTGTTCTATGGCAATCAGATGAATCTGGAATTGGTTGTGTCCTCTACTTGATTGATGTTATCGCAAGCCTTCTTA
GTGGGCGACTTGTTCGTGAACGCATTGGTCCGGCAATGTTAAGTGCAGTACAAAGTCAGATGGGTGCTGTGGAAACAAACTTTGAGGAGATCACAAACAT
CTTTAACACAGGTGGTTCCAAGGGATTACCTGGAGATTCTCTCGAAAAGATACCGAAGATCAAAATCACAAGCAATAACAACGGAGATGCAACTGGAGAA
AAAGTCGCTTGTTCAGTTTGCCTTCAGGACTTTCAACTGGGAGAGACAGTTAGAAGCTTGCCTCATTGTCATCACATGTTTCACCTACCTTGCATAGATA
AGTGGCTCCTTAAACATGCATCCTGCCCTCTGTGTAGAAGGGATCAGTGA
AA sequence
>Potri.007G061400.3 pacid=42766767 polypeptide=Potri.007G061400.3.p locus=Potri.007G061400 ID=Potri.007G061400.3.v4.1 annot-version=v4.1
MEVYPCPSRFSMSSLSSFGNFVEKVKELCNLAVSAIIGNIFSAIFTFFFALVWKFLLKELALSNAVGALLGAMTGALIGQETESGFVRGAAVGAISGAVF
SIEVFESSLVLWQSDESGIGCVLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVETNFEEITNIFNTGGSKGLPGDSLEKIPKIKITSNNNGDATGE
KVACSVCLQDFQLGETVRSLPHCHHMFHLPCIDKWLLKHASCPLCRRDQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G17730 NIP2 NEP-interacting protein 2 (.1.... Potri.007G061400 0 1
AT5G19450 CPK8, CDPK19 calcium-dependent protein kina... Potri.009G052700 2.00 0.9192 CPK7.1
AT5G54370 Late embryogenesis abundant (L... Potri.001G405650 3.16 0.9263
AT5G05800 unknown protein Potri.008G196901 6.78 0.9229
AT3G50590 Transducin/WD40 repeat-like su... Potri.005G136300 13.78 0.9150
AT2G30700 unknown protein Potri.007G133733 14.69 0.8992
AT2G30050 transducin family protein / WD... Potri.008G141300 15.49 0.9194
AT2G35110 NAPP, GRL, NAP1 NCK-ASSOCIATED PROTEIN 1, GNAR... Potri.015G124200 16.12 0.9034
AT3G01750 Ankyrin repeat family protein ... Potri.010G055700 17.20 0.9097
AT3G23610 DSPTP1 dual specificity protein phosp... Potri.010G033000 18.52 0.9103
AT1G48880 TBL7 TRICHOME BIREFRINGENCE-LIKE 7 ... Potri.002G071900 20.49 0.9047

Potri.007G061400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.