Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75850 119 / 7e-33 VPS35B VPS35 homolog B (.1) AT2G17790 102 / 1e-26 ZIP3, VPS35A ZIG suppressor 3, VPS35 homolog A (.1) AT3G51310 87 / 2e-21 VPS35C VPS35 homolog C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G110600 [exp] 152 / 2e-44 AT2G17790 1249 / 0.0 ZIG suppressor 3, VPS35 homolog A (.1) Potri.002G019400 [exp] 137 / 3e-39 AT1G75850 1271 / 0.0 VPS35 homolog B (.1) Potri.005G242100 [exp] 134 / 3e-38 AT1G75850 1309 / 0.0 VPS35 homolog B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017272 [exp] 127 / 1e-35 AT1G75850 1304 / 0.0 VPS35 homolog B (.1) Lus10013565 [exp] 125 / 8e-35 AT1G75850 1306 / 0.0 VPS35 homolog B (.1) Lus10028427 [exp] 122 / 8e-34 AT2G17790 1270 / 0.0 ZIG suppressor 3, VPS35 homolog A (.1) Lus10041880 [exp] 120 / 4e-33 AT2G17790 1261 / 0.0 ZIG suppressor 3, VPS35 homolog A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03635 [poplar] [flax] Vps35 Vacuolar protein sorting-associated protein 35
Representative CDS sequence Show only first row Show all	>Potri.007G061520.1 pacid=42766800 polypeptide=Potri.007G061520.1.p locus=Potri.007G061520 ID=Potri.007G061520.1.v4.1 annot-version=v4.1 ATGTCCAATGCGGCATGGGATAACACTGGATCAGTGTCACTCTTTGTTGAGATTCTGAACAAGTATCTTTACTTCTTCGAGAAGGGAAACCCACGTATCA CTGGGGTTGCAATCCAGAGCCTGATTGAATTGATTACAACCGAGATGCAAAGTGACAACAGTACACCAGATCCTGCTGCTGATGCTTTCTTATCCAGAAC ACTCGGATACATTCAGTTCCAGAAACAGAAAGGTGGTGCAATTGGTGAGAAATATGATCCCATCAAGGTGTGA
AA sequence Show only first row Show all	>Potri.007G061520.1 pacid=42766800 polypeptide=Potri.007G061520.1.p locus=Potri.007G061520 ID=Potri.007G061520.1.v4.1 annot-version=v4.1 MSNAAWDNTGSVSLFVEILNKYLYFFEKGNPRITGVAIQSLIELITTEMQSDNSTPDPAADAFLSRTLGYIQFQKQKGGAIGEKYDPIKV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75850		VPS35B	VPS35 homolog B (.1)		Potri.007G061520 [exp]	0	1
AT1G23230			unknown protein		Potri.010G108350 [exp]	4.47	0.8738
					Potri.003G024966 [exp]	5.91	0.8383
AT1G05020			ENTH/ANTH/VHS superfamily prot...		Potri.002G224500 [exp]	6.70	0.8065
AT5G66680		DGL1	DEFECTIVE GLYCOSYLATION, dolic...		Potri.004G157900 [exp]	8.30	0.8631
AT2G36530		ENO2, LOS2	LOW EXPRESSION OF OSMOTICALLY ...		Potri.012G129300 [exp]	12.00	0.8442
AT3G11770			Polynucleotidyl transferase, r...		Potri.019G021900 [exp]	13.52	0.7469
AT1G62440		LRX2	leucine-rich repeat/extensin 2...		Potri.018G151000 [exp]	16.37	0.8493
AT2G30395	OFP	ATOFP17, OFP17	ovate family protein 17 (.1)		Potri.019G128400 [exp]	27.96	0.7750
AT4G35830		ACO1	aconitase 1 (.1.2)		Potri.015G130201 [exp]	32.24	0.7918
AT1G78060			Glycosyl hydrolase family prot...		Potri.005G168500 [exp]	36.98	0.7953

Compare expression of checked genes

Potri.007G061520 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.