Potri.007G061540 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G110600 64 / 3e-13 AT2G17790 1249 / 0.0 ZIG suppressor 3, VPS35 homolog A (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028427 0 / 1 AT2G17790 1270 / 0.0 ZIG suppressor 3, VPS35 homolog A (.1)
Lus10041880 0 / 1 AT2G17790 1261 / 0.0 ZIG suppressor 3, VPS35 homolog A (.1)
Lus10013565 0 / 1 AT1G75850 1306 / 0.0 VPS35 homolog B (.1)
Lus10017272 0 / 1 AT1G75850 1304 / 0.0 VPS35 homolog B (.1)
PFAM info
Representative CDS sequence
>Potri.007G061540.1 pacid=42765758 polypeptide=Potri.007G061540.1.p locus=Potri.007G061540 ID=Potri.007G061540.1.v4.1 annot-version=v4.1
ATGGAGCTGAAGGAGAGGTTACTGAAGATGATTTCAAAGAGGAACAGAATTCCGTTGCACGTCTTATTCAGATGTTGTACAGTGACGACCCAGAGGAAAT
GTTTCAGATGTGTCTGCAGTGAAGAAGCATATCATGACAGGACGACCGAAGTGTATCCCTTCACAGTTCCCCCACTTGTCTTTTCGTCTCTTAAGCTCTT
GAATCAGGTGGTACTTCACTGGAAGTTGTCTTTGGTGTACAAAGATGATCATTCATCATAA
AA sequence
>Potri.007G061540.1 pacid=42765758 polypeptide=Potri.007G061540.1.p locus=Potri.007G061540 ID=Potri.007G061540.1.v4.1 annot-version=v4.1
MELKERLLKMISKRNRIPLHVLFRCCTVTTQRKCFRCVCSEEAYHDRTTEVYPFTVPPLVFSSLKLLNQVVLHWKLSLVYKDDHSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G17790 ZIP3, VPS35A ZIG suppressor 3, VPS35 homolo... Potri.007G061540 0 1
AT3G62720 ATXT1, XXT1 XYG XYLOSYLTRANSFERASE 1, xylo... Potri.010G025100 4.47 0.8126
AT5G15110 Pectate lyase family protein (... Potri.008G148800 4.79 0.7923
AT1G20140 ASK4 SKP1-like 4 (.1) Potri.009G135800 13.19 0.8335 SKP1.4
AT4G17260 Lactate/malate dehydrogenase f... Potri.008G135920 22.24 0.8133
AT2G31480 unknown protein Potri.007G127200 25.05 0.7163
AT4G33010 ATGLDP1 glycine decarboxylase P-protei... Potri.018G053680 28.98 0.7802
AT5G12250 TUB6 beta-6 tubulin (.1) Potri.012G047600 30.74 0.7941 TUB11
AT4G17260 Lactate/malate dehydrogenase f... Potri.003G111201 31.74 0.8001
AT5G66680 DGL1 DEFECTIVE GLYCOSYLATION, dolic... Potri.004G157900 33.82 0.8098
AT1G21750 ATPDI5, ATPDIL1... ARABIDOPSIS THALIANA PROTEIN D... Potri.005G179000 37.84 0.7070 Pt-PDI.2

Potri.007G061540 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.