Potri.007G061801 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G061801.1 pacid=42766793 polypeptide=Potri.007G061801.1.p locus=Potri.007G061801 ID=Potri.007G061801.1.v4.1 annot-version=v4.1
ATGAGCCAGGAGTCGATTCGAGTCGTTAAGCTCTTTCAATCAAACTGCCCTTATTCTTCTCAACATCTGCGGACCCCTGAAGTGACAGCATCCCTAGTAC
CCTTCCTCCAACTGAGCTTAGTTCTTCAAACATCTGCGCATCAGATTGGTTCACTTCCTGCCCTACGGTCTAAACCTGGAATGAATAGTTTCTGGAGAAG
TGTAAAGATCACTAGAAAGAGTTCACTATACTATATAGGCTTCTGCCGGGCTCTTATAGCTGTAATAAGGAAAGACTTCTTTTTTCAGATCAATTCTATG
GAACCAGATAAATGA
AA sequence
>Potri.007G061801.1 pacid=42766793 polypeptide=Potri.007G061801.1.p locus=Potri.007G061801 ID=Potri.007G061801.1.v4.1 annot-version=v4.1
MSQESIRVVKLFQSNCPYSSQHLRTPEVTASLVPFLQLSLVLQTSAHQIGSLPALRSKPGMNSFWRSVKITRKSSLYYIGFCRALIAVIRKDFFFQINSM
EPDK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G061801 0 1
AT5G26810 Pectin lyase-like superfamily ... Potri.013G008100 8.94 0.9142
AT3G26040 HXXXD-type acyl-transferase fa... Potri.008G034200 14.49 0.9009
AT2G13620 ATCHX15 CATION/H+ EXCHANGER 15, cation... Potri.019G123800 16.88 0.8967
Potri.012G100300 21.97 0.9009
AT5G53040 GRD, RKD4 RWP-RK domain-containing 4, GR... Potri.012G016800 22.13 0.8804
Potri.001G076350 28.28 0.8614
Potri.001G320601 30.91 0.8971
AT3G59530 LAP3 LESS ADHERENT POLLEN 3, Calciu... Potri.007G130700 44.12 0.8792
AT1G29740 Leucine-rich repeat transmembr... Potri.011G073041 80.79 0.7988
Potri.006G230650 90.79 0.8510

Potri.007G061801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.