Potri.007G062021 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G062021.1 pacid=42766054 polypeptide=Potri.007G062021.1.p locus=Potri.007G062021 ID=Potri.007G062021.1.v4.1 annot-version=v4.1
ATGCTCGATTCCCACCTCCCGCCTCTCCATCCTAGCTTAAGAAAGAATCTCACCCTTCTGCTGTCCCTGCCTCCAGCTCCAGGAACTCCTGCACCGTTCT
GCGCCTTTTTGAATGAAGCGCCTAGTTTCACCGCTTTCTTCTTACCCACGCGAGATTGGTATTCAGTCTGCCAAAACGAAACTAAAAAAGGGGTCTTTCT
AATTTCGTATATAAATGTAGATGTGGGTTGTCGGGTTTGGATCGAAATAGAATCCCCAAAAACTGGGGCATCCGTTTTCTACTTGTTCTGCTTCGATAGA
GGGGCTGTAAGTAGAATAAGAATCGTTCGCTCTTATCCTTCCTTCGCTGCAGATGGCGGAGCTACCACACGTTGA
AA sequence
>Potri.007G062021.1 pacid=42766054 polypeptide=Potri.007G062021.1.p locus=Potri.007G062021 ID=Potri.007G062021.1.v4.1 annot-version=v4.1
MLDSHLPPLHPSLRKNLTLLLSLPPAPGTPAPFCAFLNEAPSFTAFFLPTRDWYSVCQNETKKGVFLISYINVDVGCRVWIEIESPKTGASVFYLFCFDR
GAVSRIRIVRSYPSFAADGGATTR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G062021 0 1
AT4G10950 SGNH hydrolase-type esterase s... Potri.007G062342 1.41 0.7306
Potri.013G066680 13.30 0.7000
Potri.007G061741 15.49 0.7244
Potri.007G062362 15.96 0.6870
Potri.006G196300 21.07 0.5734
AT1G14060 GCK domain-containing protein ... Potri.013G109100 27.36 0.6563
Potri.015G030750 37.60 0.6305
AT2G42520 P-loop containing nucleoside t... Potri.003G217800 42.66 0.5837
AT1G61870 PPR336 pentatricopeptide repeat 336 (... Potri.004G018000 56.66 0.6320
AT5G58930 Protein of unknown function (D... Potri.001G248400 60.54 0.5879

Potri.007G062021 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.